[ICO]NameSizeDescription
[   ] 1Titulka.doc5.4M 
[   ]!!!Sekciya 6. Iformacionno - kommunikac tehn....doc5.1M 
[   ]!!!Sekciya 4. Informatika....doc5.8M 
[   ]!!!Sekciya 5. Iformatiz obraz.....doc4.1M 
[   ](08)Tleuhanova.doc303K 
[   ]+ 4 Vestnik FMO 2012 ╣3-4.doc5.2M 
[   ]+ ?aza? t│l│n o?ituda?i lingvistikali? ba?dar.doc 45K 
[   ]+ Hoja-Akhmet-Yassawi.docx3.4M 
[   ]+ Kamarova.docx5.7M 
[   ]+ KASACHISCHER VEKTOR DER CHINESISCHEN MIGRATION.doc423K 
[   ]+ Kassymbekova.docx5.2M 
[   ]+ Kategoriya nakloneniya kak yavlenie i sredstvo virazheniya diskursa.doc2.4M 
[   ]+ KAZAHSTANSKIY VEKTOR KITAYSKOY MIGRACII.doc431K 
[   ]+ MIGRATION OF ETHNIC KAZAKHS TO HISTORICAL NATIVE LAND.doc 30K 
[   ]+ Natsional'nye-aspekty.docx 83K 
[   ]+ Osobennosti-motivatsii.docx 19M 
[   ]+ Osobennosti-vremennoj-perspektivy-osuzhdennykh.docx 19M 
[   ]+ Salistiru konstrukciyalarini? semantikali? ??rilimi.doc 53K 
[   ]+ Thmosn WEB OF KNOWLEDGE.docx 74K 
[   ]+ Turkmen-mode-of-life.docx4.5M 
[   ]+ Zhay s?ylemdeg│ sub'ekt│n│? ??rilimdi?, semantikali? erekshel│kter│.docx4.1M 
[   ]+Istochniki deviacii v sovremennom kazahstanskom obshestve.doc 49K 
[   ]+Nac. Duh i process.doc 94K 
[   ]+Sbornik - NASLEDIE L.N. GUMILEV-Nurhan 24052013.doc 61M 
[   ]+Vestnik 1, 2013-Seilhan 23052013.pdf5.6M 
[   ]- Zhurnali s impakt-faktorom.docx251K 
[   ]-Angidroaustricin iz Artemisia albida Willd.pdf598K 
[   ]-EFIRNOE MASLO I METIL-3-[S-GIDROKSIPRENIL]-KUMARAT IZ ARTEMISIA COMMUTATA BESS.pdf1.6M 
[   ]-Fitohimicheskoe issledovanie Calligonum tetrapterum.pdf1.6M 
[   ]-Flavonoidi poliney Kazahstana.pdf683K 
[   ]-Flavonol Caempferol and its glycoside from Calligonum tetrapterum.pdf629K 
[   ]-Flavonol kempferol i ego glyukozid.pdf1.4M 
[   ]-Himicheskiy sostav nekotorih vidov kazahstanskih rasteniy.pdf526K 
[   ]-Investigation of chemical composition of some species of Artemisia Family.pdf635K 
[   ]-Issledovanie antioksidantnoy aktivnosti ekstraktov Haloxylon aphyllum (Minkw) Iljin.pdf1.2M 
[   ]-Kompleksnoe himicheskoe ispol'zovanie Artemisia leucodes Shrenk.pdf1.2M 
[   ]-Komponenti Peucedanum morisonii.pdf936K 
[   ]-New Phenolic Compounds from Artemisia commutata and A. glauca.pdf439K 
[   ]-Noviy 5,7,4ĺ-trigidroksi-2ĺ-metoksi-2-fenoksihromon A.glauca.pdf1.8M 
[   ]-Problemi nauki v Kazahstane i puti ih resheniy.pdf2.8M 
[   ]-Secondary metabolites of Artemisia commutata Bess.pdf645K 
[   ]-Sintez protivoopuholevogo tiazol'nogo proizvodnogo platanovoy kisloti.pdf1.7M 
[   ]-Sostav i antimikrobnaya aktivnost' efirnogo masla A.kasakorum.pdf2.0M 
[   ]-Synthesis of phosphorcontaining derivatives of carvotanacetone.pdf2.4M 
[   ]-tekhnika 4,2012.pdf 40M 
[   ]-Termodinamicheskie svoystva kristallicheskogo proizvodnogo.pdf1.1M 
[   ]-Termohimiya i ocenka termodinamicheskih svoystv monoterpenoida oksima cikloartemiziaketona.pdf1.6M 
[   ]-Termohimiya seskviterpenovogo laktona matrikarina.pdf1.1M 
[   ]-Vtorichnie metaboliti Artemisia commutata Bess.pdf1.6M 
[   ]0439.docx1.2M 
[   ]1 Sbornik dokladov i vistupleniy ľ Ierusalim, 2008 12-15 str.docx 56K 
[   ]1-s2.0-S0022311508008581-main.docx341K 
[   ]1-s2.0-S0022311510002515-main.docx299K 
[   ]1. Opisanie.docx 34K 
[   ]1.docx 0  
[   ]1.png 75K 
[   ]10 (1).docx 99K 
[   ]10.docx217K 
[   ]1014352.pdf213K 
[   ]102762.pdf6.6M 
[   ]11 (1).docx211K 
[   ]11.docx113K 
[   ]110maksimkin.docx226K 
[   ]112.pdf.docx799K 
[   ]12.docx768K 
[   ]12040.pdf3.8M 
[   ]122.docx336K 
[   ]13.docx217K 
[   ]1344946061.pdf118K 
[   ]1348001524.pdf171K 
[   ]14.docx 87K 
[   ]145689-285170.pdf3.7M 
[   ]15.docx687K 
[   ]16.docx106K 
[   ]17.docx288K 
[   ]1920-30 zhildarda?i o?u-?ilimi m?t│nder│ t│l oramdili?ini? ?aliptasu tarihi.docx6.2M 
[   ]1977 Dif. urav. T13 N7.pdf5.8M 
[   ]1977 Doclad AN SSSR T235 N4.pdf2.1M 
[   ]1977 Izv AN Kaz SSR N1.pdf2.4M 
[   ]1977 Izv AN Kaz SSR N5.pdf1.8M 
[   ]1977 Kar. gos. univ. Mat. zam. V 4.pdf7.2M 
[   ]1977 Sib. mat. zhurnal T18 N5.pdf8.0M 
[   ]1979 Izv. AN Kaz. SSR N3.pdf1.6M 
[   ]1979 Mat. sbornik AN SSSR.pdf9.7M 
[   ]1979 Mat. zam. T25 N3.pdf2.1M 
[   ]1979 Mat. zam. T25 N4.pdf910K 
[   ]1979 O sush. samonapryazh. odnogo dif. operatora..pdf2.1M 
[   ]1979 Sib. mat. zhurnal. T XX N 2.pdf2.0M 
[   ]1980 Mat. sbornik AN SSSR.pdf 15M 
[   ]1981 math zam t 29 n6 ru.pdf545K 
[   ]1984 Amer. Math. Soc. Transl. Vol. 2 N 122.pdf4.6M 
[   ]1984 Izv. AN Kaz. SSR N3.pdf2.2M 
[   ]1984 Izv. AN Kaz. SSR N5.pdf2.6M 
[   ]1984 Sib. mat. zhurnal AN SSSR T XXV N6.pdf6.3M 
[   ]1985 Doclad AN SSSR T284 N1.pdf1.5M 
[   ]1988 Dif. urav. T24 N4.pdf4.0M 
[   ]1988 Trudi MI AN SSSR. O koer. ocenkah resh. raznost. urav. T.pdf3.4M 
[   ]2.png 47K 
[   ]2.tif3.0M 
[   ]2001.pdf336K 
[   ]2004-02-00006.pdf134K 
[   ]2004-03-00006.pdf100K 
[   ]2005-02-00018.pdf134K 
[   ]2005-04-00005.pdf1.2M 
[   ]2006-05-00028.pdf173K 
[   ]2006-06-00028.pdf167K 
[   ]2006-1.doc 32K 
[   ]2006-2.doc157K 
[   ]2007-1.doc 97K 
[   ]2007-1.pdf1.5M 
[   ]2007-2.doc 45K 
[   ]2007-3.doc 46K 
[   ]2007.pdf530K 
[   ]20071.pdf445K 
[   ]2008-1.doc 54K 
[   ]2008-2.doc 98K 
[   ]2009-4.doc 97K 
[   ]2009.pdf386K 
[   ]2010-1-20.pdf1.8M 
[   ]2010-1.doc185K 
[   ]2010-2.doc291K 
[   ]2010-3.doc198K 
[   ]2010.pdf529K 
[   ]2010_alim1.pdf3.8M 
[   ]2010_alimgazin.pdf3.8M 
[   ]2010_Alimgazin1.pdf3.8M 
[   ]2010_Ibraev.pdf388K 
[   ]2010_Karimov.pdf1.3M 
[   ]2010_Karimov2.pdf1.3M 
[   ]2010kariomv22.pdf1.3M 
[   ]2011 academic.pdf228K 
[   ]2011 professor.pdf669K 
[   ]2011-10.pdf197K 
[   ]2011-11.pdf715K 
[   ]2011-7.pdf401K 
[   ]2011-8.pdf362K 
[   ]2011-9.pdf198K 
[   ]2011.pdf343K 
[   ]2011_berikbaev.pdf1.0M 
[   ]2011_gachenko.pdf1.3M 
[   ]2011_Vobecky_1.page1.pdf202K 
[   ]2011_Vobecky_1.pdf963K 
[   ]2012-03-10.pdf286K 
[   ]2012-07-03.pdf288K 
[   ]2012031466857249.pdf170K 
[   ]2012_06.pdf3.4M 
[   ]2012_10.pdf3.3M 
[   ]2012_ibrayev-jkh.pdf562K 
[   ]2013_satinova_Jougn_European.pdf1.5M 
[   ]308993g.pdf1.6M 
[   ]39616.docx292K 
[   ]4.tif2.8M 
[   ]40548.pdf3.9M 
[   ]42157.pdf2.1M 
[   ]42159.pdf4.7M 
[   ]4527.pdf4.0M 
[   ]4565.docx 47K 
[   ]4593.pdf1.9M 
[   ]5.tif2.6M 
[   ]52553.docx941K 
[   ]5458.pdf4.6M 
[   ]55555.pdf4.0M 
[   ]6.docx437K 
[   ]6.tif2.6M 
[   ]7855.pdf5.3M 
[   ]78785.pdf1.8M 
[   ]8.docx335K 
[   ]8667.pdf438K 
[   ]?. Kek│lbaev zh?ne memlekett│k t│l m?seles│.doc 51K 
[   ]??RILIS MATERIALDARI ?ND▓R▓S▓ SALASINDA?I BASIMDI?.doc175K 
[   ]?ARZHI POLICIYASI AKADEMIYASI TI?DAUSHILARINI? DZYUDO.docx204K 
[   ]?ASIRDI? ?AZHAP SA?LA?I ?AZHIM??AN.docx212K 
[   ]?atisti? sin es│mderd│? leksikali? t│rkes│md│l│g│.docx 60K 
[   ]?AZA? BASPAS?Z▓ TARIHINI?.doc 46K 
[   ]?aza? - ?ltti? ruh zharshisi_ Ertasova ma?ala.doc 73K 
[   ]?aza? antroponimzhasamdi? zh?yes│n│? tarihi neg│zder│.docx3.9M 
[   ]?aza? t│l│n o?ituda?i lingvistikali? ba?dar.doc 43K 
[   ]?aza? t│l│ndeg│ ?os ?izmett│ t?l?alardi? t│ld│k tabi?ati.doc 55K 
[   ]?aza? t│l│ndeg│ antroponimzhasamdi? t?l?alardi? ?aliptasu zholdari.docx3.2M 
[   ]?aza? t│l│n│? ?ilim t│l│ ret│ndeg│ ma?izi men m?n│ ha?inda.doc 67K 
[   ]?aza?- Sak.doc 62K 
[   ]?AZA?.doc 40K 
[   ]?AZA?STANDA?I M?DENI SAYASAT Zh?NE SAYASI M?DENIETT▓?.docx 30K 
[   ]?AZA?STANNI? MEMLEKETT▓K M?DENI.docx 37K 
[   ]?AZA?TI1.doc 46K 
[   ]?aza?ti? d?st?rl│ ?deb│n│? m?deni-?leumett│k erekshel│kter│.docx 28K 
[   ]?aza?ti? so??i redaktori.doc 66K 
[   ]?AZA?TI?.doc143K 
[   ]?AZ▓RG▓ ZHO?ARI B▓L▓M SAPASIN BAS?ARU.docx205K 
[   ]?B▓Sh KEK▓LBAEV SHI?ARMALARINDA?I METAFORALARDI? ?OLDANISI.doc 63K 
[   ]?B▓Sh KEK▓LBAEVTI? T▓LD▓K T?L?ASI.doc 60K 
[   ]?ilimi m?t│nderdeg│ aktualdi m?shelenu zhayinda.docx4.7M 
[   ]?ilimi t│l sintaksis│n│? keyb│r erekshel│kter│ (zhalpi m?seleler).docx4.9M 
[   ]?IZMETKERLER ??RAMINI? MOTIVACIYASIN BAS?ARUDI?.doc 70K 
[   ]?lemdeg│ ?aza? ?auimdasti?ini? damu k?kzhiekter│.doc 44K 
[   ]?ltti? ?ayta ?rleu│ne ?z│nd│k ?les.doc 48K 
[   ]?LTTI? ?IMIL OYINDARINI? ?LEUMETT▓K Zh?NE.docx207K 
[   ]?LTTI? OYINDAR NEG▓Z▓NDE STUDENTTERD▓?.docx204K 
[   ]?RKENIET TALABI ľ SALAUTTI ?M▓R SALTI.docx203K 
[   ]?TELBAEV M korrektirovanniy.docx2.8M 
[   ]?└ă└?ĐĎ└══█? ╠┼╠╦┼╩┼ĎĎ▓╩ ╠?─┼═╚.docx 37K 
[   ]A mathematical model of biological resource dynamics, using CaspianUral sturgeon as a case study.docx 94K 
[   ]A Note on.docx 79K 
[   ]A Progress Report of Implementation (2).pdf149K 
[   ]A Progress Report of Implementation.pdf149K 
[   ]a-closed.pdf277K 
[   ]a-lower-bound.pdf269K 
[   ]A-many-parameter.pdf185K 
[   ]A-Note-on.pdf290K 
[   ]A-Sharp-Remez.pdf1.0M 
[   ]A-source-identification-problem-related-to-mathematical-model-of-laser-surface-heating.pdf227K 
[   ]A-source-identification.pdf321K 
[   ]a.amar.pdf511K 
[   ]A.MARGULANNYN-ETNOTARYHY.pdf165K 
[   ]a14.pdf6.0M 
[   ]A9R4FC2.pdf571K 
[   ]A9RF116.pdf937K 
[   ]A? k?ylek azamat.doc 51K 
[   ]A_Study_of_Polycarbonyl_Compounds_in_Magnegases.pdf156K 
[   ]A_Study_of_the_Energy_Efficiency_of_Hadronic_Reactors_of_Molecular_Type.pdf168K 
[   ]abai-alemi.pdf265K 
[   ]ABAI-AUDARMALARY.pdf166K 
[   ]Abai-kara.pdf182K 
[   ]abai-mektebi-takiribinin.pdf237K 
[   ]Abai-poeziyacyndagy.pdf201K 
[   ]ABAI-TILDIK-TULGASY.pdf204K 
[   ]Abai.pdf206K 
[   ]abaidani-tanu-aserleri.pdf185K 
[   ]abdikarim.doc 77K 
[   ]abdikarim2.doc 46K 
[   ]abdygaliyeva.doc 49K 
[   ]Abetova Z.T..doc 97K 
[   ]abitanu-gylimina.pdf272K 
[   ]Abitiva_France-December-2012-Conference-Titul list.jpg 64K 
[   ]Abitova-USA_KAZAKHSTAN_Titul list of Journal_2010.jpg2.5M 
[   ]Abitova01_ICECCS-2012_Final.pdf125K 
[   ]Abitova_Budapesht-2011-Titul list of Confernce.jpg 83K 
[   ]Abitova_Bulgatia_Journal-2010-Titul list.jpg349K 
[   ]Abitova_Canada-2011-Titul list of Conference.jpg 97K 
[   ]Abitova_CSDM_2012_FINAL PAPER.pdf208K 
[   ]Abitova_France-December-2011-Conference-Titul list.jpg 61K 
[   ]ABITOVA_FUL PAPER-SPIE.pdf1.0M 
[   ]ABITOVA_FUL PAPER_IEEE_1.pdf1.0M 
[   ]Abitova_Harvard-USA_2012-Titul list of Journal.jpg124K 
[   ]Abitova_Malasiya_2012-Titul of Conference.jpg188K 
[   ]Abitova_Paris-France_July-2012-Titul list -Conference.jpg1.7M 
[   ]Abitova_Turkey-2012-Titul list.jpg 48K 
[   ]Abitova_USA_2011-Titul list of Conference.jpg 80K 
[   ]Abstract_Book 2002.pdf2.4M 
[   ]Abstract_rus.docx1.1M 
[   ]Abstract_rus.page001.pdf265K 
[   ]Abstract_rus.pdf1.7M 
[   ]AbstractBook.page001.pdf877K 
[   ]AbstractBook.pdf4.7M 
[   ]Abstracts_rus.page001.pdf208K 
[   ]Abstracts_rus.pdf1.4M 
[   ]ACADEMIC.pdf247K 
[   ]Accelerated-expansion.pdf162K 
[   ]Accelerating-cosmology.pdf112K 
[   ]Acoustic Emission of Growing Microcracks in Vibration-Loaded Material.pdf 87K 
[   ]ADIL-DUISENBEK.pdf168K 
[   ]agalardin-algayunda.pdf170K 
[   ]agilshin-tili-pani.pdf1.1M 
[   ]AGRO?NERK?S▓P KESHENDE INNOVACIYALI? DAMU.doc 65K 
[   ]AGROTOURISM AS THE ELEMENT OF MULTIPURPOSE DEVELOPMENT.docx 38K 
[   ]agylshyn.pdf194K 
[   ]ahmetov-zhas.doc2.7M 
[   ]Aibergenov.pdf187K 
[   ]aitmagambetova1.pdf922K 
[   ]aitmagobetova.pdf946K 
[   ]aituly-alashtanushy.pdf190K 
[   ]aitystyn.pdf277K 
[   ]Ajania fruticulosa (Ldb.) Poljak.pdf1.3M 
[   ]akhmetbaev-jkh.pdf1.8M 
[   ]akilbekov _0.doc5.1M 
[   ]aktual'nie voprosi.docx 24K 
[   ]akyn-juregi.pdf242K 
[   ]AKZU-TILIM.pdf149K 
[   ]Al'yansi kak forma monopol'nogo kontrolya.doc224K 
[   ]al311.pdf176K 
[   ]alash-amanatin.pdf185K 
[   ]alash-dep-sokkan.pdf205K 
[   ]alash-muratina-adaldik.pdf176K 
[   ]alash-tuin-taza.pdf203K 
[   ]alash-urandi-azamat.pdf176K 
[   ]alem.pdf242K 
[   ]Algoritmi raspoznavaniya kazahskogo slova kak celogo. Strukturnaya klassifikaciya slov kazahskogo yazika.pdf5.5M 
[   ]alimgazin-jkh.pdf1.8M 
[   ]alimgazin.pdf863K 
[   ]alpeisova.doc 64K 
[   ]alpeisova2.doc 28K 
[   ]Alya_Scopus.jpg281K 
[   ]Amar.pdf151K 
[   ]amirbekovtin-kuttyktayu.pdf217K 
[   ]ANALITIKALYK-TASILMEN-ZHASAU.pdf155K 
[   ]ANALIZ DINAMIKI RASPREDELENIYa PASSAZHIROPOTOKOV NA ALMATINSKOM METRO Pdf.pdf256K 
[   ]Analiz vzaimosvyazi mezhdu pryamimi inostrannimi investiciyami.docx153K 
[   ]analiz-metodov.pdf278K 
[   ]analiz-mutacii-lekarstvennoy-rezistatnosty.pdf258K 
[   ]Ani?tamali s?ylemder.docx5.9M 
[   ]anomalously.pdf826K 
[   ]ansarik-tauelsizdik-boldi.pdf189K 
[   ]Antiproton scattering off 3He and 4He nuclei at low and intermediate energies.pdf414K 
[   ]Antroponimzhasam men leksikologiyani? ?zara baylanisi men erekshel│kter│.docx3.6M 
[   ]Antroponimzhasamni? t│l b│l│m│n│? ?zge salalarimen baylanisi.docx3.0M 
[   ]Apparat issledovaniya logisticheskih sistem.jpg685K 
[   ]Apparat issledovaniya logisticheskih sistem.pdf1.3M 
[   ]Apparat issledovaniya logisticheskih sistem1.jpg788K 
[   ]Apparat issledovaniya logisticheskih sistem2.jpg784K 
[   ]Apparat issledovaniya logisticheskih sistem3.jpg793K 
[   ]Apparat issledovaniya logisticheskih sistem4.jpg781K 
[   ]Apparat issledovaniya logisticheskih sistem5.jpg770K 
[   ]Apparat issledovaniya logisticheskih sistem6.jpg830K 
[   ]Apparat issledovaniya logisticheskih sistem7.jpg664K 
[   ]Apparat issledovaniya logisticheskih sistem8.jpg317K 
[   ]APPLICATION OF CELLULAR BIOTECHNOLOGY FOR STORAGE.docx 54K 
[   ]APPLICATION OF CELLULAR BIOTECHNOLOGY.pdf1.6M 
[   ]Application-of-Interpolational.pdf205K 
[   ]application.pdf435K 
[   ]AR-UYAT-KONCEPTILERI.pdf157K 
[   ]Arab-korkem.pdf284K 
[   ]argumentaciya.pdf506K 
[   ]Artemisia filatovae A.N. Kuprianov.pdf1.4M 
[   ]Artemisia-absinthium-L.and-A.kasakorum-(Krasch.)-Pavlov-essential-oil-constituents-from-Kazakstan.pdf2.4M 
[   ]article-mmf2.pdf195K 
[   ]article1.pdf426K 
[   ]Article3.pdf291K 
[   ]article_2000_4_139.docx117K 
[   ]article_2001_4_69.docx245K 
[   ]article_2002_3_23.docx292K 
[   ]article_2003_3_35.docx538K 
[   ]article_2007_2_142.docx938K 
[   ]article_2007_6_97.docx717K 
[   ]article_2008_2_100.docx702K 
[   ]article_2011_2_108.docx646K 
[   ]article_2012_2_83.docx444K 
[   ]article_2012_5_69.docx467K 
[   ]articlemm3.pdf154K 
[   ]articlemmf1.pdf561K 
[   ]articlemmf4.pdf183K 
[   ]articlemmf5.pdf513K 
[   ]articlemmf6.pdf1.3M 
[   ]asemdik-ataulary.pdf270K 
[   ]Asimptotika.pdf2.5M 
[   ]aspaly-kopirlerdegi.pdf634K 
[   ]Assambleya narodov Kazahstana k voprosu ob istorii sozdaniya i deyatel'nosti.doc 45K 
[   ]ASSESSMENT.pdf183K 
[   ]ASTANA-KALASY.pdf151K 
[   ]ASTANA.docx 34K 
[   ]astana.pdf280K 
[   ]audarmanyn-madeniettanulyk.pdf241K 
[   ]AUDARUSHYNYN-MINDETI-AUDARU-EMES.pdf130K 
[   ]Auezov.pdf176K 
[   ]avtomabilnye-perevozki.pdf450K 
[   ]avtomatizaciya.pdf534K 
[   ]avtoradiograficheskoi-metod-issledovanie-lishainikov-s-terrotorii-Semipalatinskogo-ispitatelnogo-poligona.pdf2.1M 
[   ]Axmet-Baitursynuly.pdf272K 
[   ]Axmet.pdf280K 
[   ]ayagannin-kuttyktayu.pdf214K 
[   ]aziyalyk.pdf365K 
[   ]B.BABASH.pdf178K 
[   ]baganalyk-zhasushalardyn.pdf200K 
[   ]Baitursynov.pdf243K 
[   ]Baitursynuly.pdf195K 
[   ]Baizhumanov.pdf192K 
[   ]Baldybek_Otelbaev[1].pdf252K 
[   ]Bank card.pdf 87K 
[   ]BAS-SARDAR.pdf392K 
[   ]baskaru-kurylgysyn.pdf450K 
[   ]baubekov.pdf1.1M 
[   ]Bayanauyl.pdf1.1M 
[   ]Beisenbi_Scopus.jpg285K 
[   ]BEIVERBALDY-AMALDAR.pdf151K 
[   ]BERDIKOZHA-BATYR.pdf1.4M 
[   ]BEZHECK-ETO-MOIA-OTCHIZNA.pdf194K 
[   ]Bezrabotica i obespechenie zanyatosti v Respublike Kazahstan.doc 53K 
[   ]Biologia.pdf4.1M 
[   ]Biological sciences.docx 19K 
[   ]Biology_3_67_2012.pdf1.9M 
[   ]biophys0942_abstract.pdf7.2K 
[   ]biotechnology.doc2.6M 
[   ]bol.doc327K 
[   ]Book of Abstracts Lumdetr2009.pdf6.2M 
[   ]book1_seminar1.pdf4.8M 
[   ]BOR'BY-S-HRONOSOM.pdf237K 
[   ]BRAS961.pdf199K 
[   ]BRST Approach to Hamiltonian Systems.pdf423K 
[   ]bspasoz-jetkinshekterge.pdf410K 
[   ]BUGINGI-KAZAK-BASPASOZI.pdf151K 
[   ]Builleten-4-2011-kaz.doc461K 
[   ]Burenkov and Otelbaev.pdf270K 
[   ]CE_Conf_2011_site.pdf4.1M 
[   ]Cenovaya konkurenciya motivi i posledstviya.doc466K 
[   ]CENTRAL'NAIA-AZIA-V-KONTEKSTE.pdf240K 
[   ]chelovecheskii-kapital.pdf283K 
[   ]CHELOVEK-PRIRODA.pdf192K 
[   ]Chemical-Composition-and-Antioxidant-Activity-of-the-Oils-of-some-Artemisia.pdf1.4M 
[   ]Chemical-composition-of-essential-oils-of-Umbelliferae-spesies.pdf602K 
[   ]CHEMICAL_COMPOSITION_AND.pdf 84K 
[   ]Chislennoe-modelirovanie-dinamicheskih-ispitanii-svai-i-sravnenie-poluchennih-resultatov-s-naturnimi-dannimi.pdf918K 
[   ]Cibermetrics2011.page001.pdf198K 
[   ]cikl-kod.doc164K 
[   ]CIRSILINEOL AND CUBREUVA LACTONE.pdf 55K 
[   ]CIVILIZACIONNOE.pdf240K 
[   ]Combinatorial_interpretation_of_Haldane-Wu_fractional_exclusion_statistics.pdf100K 
[   ]comparative.pdf153K 
[   ]Comparative_Analyiss_of_Englih_Kazakh_and_Russian_Animalistic_Nomination.pdf199K 
[   ]COMPARISON-ANALYSIS.pdf504K 
[   ]Components-of-Senecio-viscosus-L.pdf656K 
[   ]Composition-of-essential-oil-of-Artemisia-dracunculus-L.-(tarragon)-from-Kazakhstan-obtained-by-supercri.pdf413K 
[   ]Composition-of-Resin-Volatile-Fraction-from-Filipendula-ulmaria.pdf112K 
[   ]Composition-of-supercritical-CO2-extracts-of-Artemisia-species-from-Kazakhstan.pdf2.9M 
[   ]concerning.pdf503K 
[   ]Condation-for-exictence-of-a-global-strong-solution-to-one-class-of-nonelinear-evalution-equations-in-hilbert-space.pdf183K 
[   ]Conditional_Lagrangian_acceleration_statistics_in_turbulent_flows_with_Gaussian_distributed_velocities.pdf255K 
[   ]conditions-for-existance.pdf183K 
[   ]Conditions-for-the-Existence-of-a-Global-Strong-Solution.pdf1.3M 
[   ]conditions.pdf183K 
[   ]conditionswforthe.pdf1.3M 
[   ]Confer IYAF-2005.pdf8.9M 
[   ]conference in LAHORE.pdf 98K 
[   ]Conference of the International Journal of Arts and Sciences.pdf 52K 
[   ]ConferenceBook_Bulgaria.pdf572K 
[   ]conferences and publication.doc 45K 
[   ]content_NNC_RK_Bulletin_4_36_2008.docx6.4M 
[   ]content_NNC_RK_Bulletin_4_36_2008.docx.filepart1.2M 
[   ]content_NNC_RK_Bulletin_4_36_2008.page001.pdf1.0M 
[   ]content_NNC_RK_Bulletin_4_36_2008.pdf5.6M 
[   ]Continuous-Dependence-of-the-Solution-of-a-Parabolic-Equation-in-a-Hilbert-Space-on-the-Parameters-and-Initial-Data.pdf513K 
[   ]Continuous-Dependence.pdf513K 
[   ]Control-Problem-with-a-Point-Source-of-Heat-Used-as a-Controller.pdf195K 
[   ]control-problem-with.pdf195K 
[   ]Convolution-Inequalities.pdf482K 
[   ]Cosmological-evolution-of-equation-of-state-for-dark-energy-in-G-essence-models.pdf308K 
[   ]Crucial-Role-for-Milk-Xanthine-Oxidoreductase-in-Convertion-of-Toxic-Nitrat-eand-Nitrite-to-Physiological-Important-Nitric-Oxide .pdf881K 
[   ]D.ISABEKOV-ANGIMELERI.pdf196K 
[   ]D.ISABEKOV-SHYGARMALARY.pdf171K 
[   ]DAN RF_rus_beg.pdf543K 
[   ]DAN RF_rus_end.pdf474K 
[   ]DAN RT 2009, ╣10.PDF3.8M 
[   ]DANMath6_10OtelbaevLO.pdf206K 
[   ]Dauletbekova 2011.pdf112K 
[   ]Dauletbekova Central Eur J Phys 2011.pdf401K 
[   ]Dauletbekova FTT 1982.pdf1.5M 
[   ]Dauletbekova InorgMat 2011.pdf117K 
[   ]Dauletbekova IZV Vuzov 1-3-2008.pdf2.0M 
[   ]Dauletbekova Izv vuzov 11 3 2011.pdf5.4M 
[   ]Dauletbekova Izv Vuzov 8-2. 2009.pdf1.3M 
[   ]Dauletbekova Izvestiya NAN RK 1-2010.pdf1.8M 
[   ]Dauletbekova Izvestiya NAN RK 1-2009.pdf1.6M 
[   ]Dauletbekova Izvestiya NAN RK 2007.pdf5.5M 
[   ]Dauletbekova Izvestiya TPU 2009.pdf287K 
[   ]Dauletbekova Material Sci. and Eng 2-12.pdf1.5M 
[   ]Dauletbekova Material Sci. and Eng 2010.pdf758K 
[   ]Dauletbekova NeorgMat 2011.pdf128K 
[   ]Dauletbekova NIMB 2010.pdf592K 
[   ]Dauletbekova NIMB 295 2013.pdf706K 
[   ]Dauletbekova Nuclear&Renewable energy Ankara 2010.pdf1.5M 
[   ]Dauletbekova Optics and spectros 2012.pdf199K 
[   ]Dauletbekova Optika i spektros 1982.pdf789K 
[   ]Dauletbekova Optika i spektros 2012.pdf172K 
[   ]Dauletbekova phc 2013 1.pdf884K 
[   ]Dauletbekova phc 2013 2.pdf898K 
[   ]Dauletbekova phys stat sol b 1981.pdf1.8M 
[   ]Dauletbekova phys.stat sol 1982.pdf593K 
[   ]Dauletbekova phys.stat. 1985.pdf590K 
[   ]Dauletbekova phys.stat.sol.2010.pdf905K 
[   ]Dauletbekova Vestnik enu 2011.pdf1.4M 
[   ]Dauletbekova Vestnik KarGU.pdf6.2M 
[   ]DauletbekovaPhysica B 2010.pdf152K 
[   ]DAUYSSYZ-FONEMALAR-ZHIKTELIMI.pdf160K 
[   ]DBLP_ Gulnara Abitova.pdf293K 
[   ]deformation.pdf228K 
[   ]dekodirovanie.pdf469K 
[   ]delfi.pdf639K 
[   ]Denying-the-Dichotomy.pdf208K 
[   ]Description-of-Interpolation.pdf1.2M 
[   ]DIALOG-EURAZIA.pdf299K 
[   ]Dif.urav.T.XIII.12.pdf709K 
[   ]difeq8_10v46cont_ENGLISH.pdf123K 
[   ]Diff.ur. T.XVII ╣5.pdf7.4M 
[   ]DIFFERENTIATION.pdf159K 
[   ]diffraction.pdf175K 
[   ]dispecherecacia-transpornih-sredstv-na-trudodostupnih-uchastkah-s-primeneiem-sputnikovih-tehnalogii.pdf1.0M 
[   ]DISPUTE -BETWEEN.pdf123K 
[   ]Dissipati_vetunnelingin_structures_with_quantum_dots_and_quantum_molecules.pdf492K 
[   ]dissipativnye.pdf481K 
[   ]dizainda-etnostildik.pdf229K 
[   ]DKM391.pdf152K 
[   ]dnevnye.pdf518K 
[   ]Doc1.pdf2.3M 
[   ]Doc2.pdf619K 
[   ]DOK.AN.SSSR.T.271.╣6.pdf2.5M 
[   ]DOK.AN.SSSR.T234,╣3.pdf3.0M 
[   ]DOK.AN.SSSR.T234,╣6.pdf3.2M 
[   ]DOK.AN.T235,╣6.pdf3.2M 
[   ]DOK0317.pdf177K 
[   ]Dokl. AN SSSR T.259 ╣1.pdf1.6M 
[   ]Dokl. AN SSSR T.265.╣4.pdf2.1M 
[   ]Dokl.AN RF ╣4.pdf2.9M 
[   ]Dokl.AN SSSR.pdf2.7M 
[   ]Dokl.AN ╣5.pdf2.2M 
[   ]Doklad ╣2.pdf3.4M 
[   ]Doklad ╣4.pdf4.6M 
[   ]Doklady-plenarnogo-zasedania.pdf157K 
[   ]Dokt.diss..pdf 12M 
[   ]Dokument Microsoft Office Word.docx 16K 
[   ]Dokument Microsoft Word.doc 41K 
[   ]dom sapara.docx 43K 
[   ]Dopolneniya4.pdf9.8M 
[   ]Dosanova G.doc 64K 
[   ]Dosanova GM sociologiya.doc 44K 
[   ]Dosanova VAK 2.doc 70K 
[   ]doska.pdf162K 
[   ]Doument2.pdf1.1M 
[   ]DREVNETIURKSKIE-TITULY.pdf378K 
[   ]DREVNIAIA-ISTORIA-MAD'IAR.pdf295K 
[   ]DU tom25.pdf7.4M 
[   ]DU.T.XIII.╣1.pdf8.4M 
[   ]duman.pdf192K 
[   ]duniejuzilik.pdf196K 
[   ]DVIZHENIA-ALASH.pdf156K 
[   ]dvustoronnie-ocenki.pdf1.9M 
[   ]dyni.pdf210K 
[   ]Earth-from-space(2003).pdf1.3M 
[   ]ECO 2004.pdf361K 
[   ]ECO Awards 2004.pdf356K 
[   ]edinaya-mirovaya.pdf181K 
[   ]edinaya.pdf201K 
[   ]EFFECTIVENESS.pdf135K 
[   ]Effektivnoe funkcionirovanie prodovol'stvennogo rinka na osnove.docx 87K 
[   ]egipetskii-krizis.pdf187K 
[   ]Einstein-Cartan gravity with scalar-fermion interactions.PDF113K 
[   ]Einstein-Cartan-gravity-with-scalar-fermion-interactions.pdf117K 
[   ]Einstein-Cartan.docx 88K 
[   ]Einstein-Cartan.pdf103K 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniya.jpg273K 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniya1.jpg492K 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniya2.jpg497K 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniya3.jpg1.0M 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniya4.jpg1.0M 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniya5.jpg683K 
[   ]Ekologicheskie proyulemi DVS i puti ih resheniyaPdf.pdf1.0M 
[   ]ekologicheskie.pdf345K 
[   ]Ekonomicheskaya kategoriya monopoliya sushnost' soderzhanie i faktori ustoychivosti.doc 99K 
[   ]Ekonomicheskaya koncentraciya kak faktor monopolizacii ekonomiki.doc138K 
[   ]EKONOMICHESKAYa MISL' KAZAHSTANA.doc 54K 
[   ]Ekonomicheskaya teoriya na novom vitke.doc 51K 
[   ]Ekonomicheskie krizisi mehanizmi i faktori razvitiya.doc693K 
[   ]EKONOMIKOľADMINISTRATIVNIE BAR'ERI DLYa KONKURENCII.doc 78K 
[   ]eksperementalnyi-morfogenez.pdf201K 
[   ]el-augan.pdf245K 
[   ]Electrochemical ChlorineFree AC Disinfection of Water Contaminated with Salmonella Typhimurium Bacteria.pdf179K 
[   ]elektromagnitnoe-pole-tochechnogo-elektricheskogo-dipolia-v-odnoosnii-anizatropnii-srede.pdf1.2M 
[   ]elektromagnitnogo-pole-elektricheskogo-i-magnitnogo-dipolei-v-odnoosnim-kristale.pdf1.8M 
[   ]ELEMENTARY.pdf239K 
[   ]ELEMENTY-LANDSHAFTOV.pdf197K 
[   ]emj70.pdf371K 
[   ]emj79.pdf320K 
[   ]empirisheskie.pdf865K 
[   ]Energosberejenie-teplovih-punktah-jilih-i-obwestvennih-zdanii-.pdf317K 
[   ]English.pdf465K 
[   ]entropy-14-02351-v2.pdf195K 
[   ]ENU mat. zhurnal UDK 517.946(Otelbaev).pdf 12M 
[   ]enu_doc (1).doc 61K 
[   ]enu_doc (10).doc 38K 
[   ]enu_doc (11).doc 33K 
[   ]enu_doc (12).doc3.0M 
[   ]enu_doc (13).doc 34K 
[   ]enu_doc (14).doc 36K 
[   ]enu_doc (15).doc 38K 
[   ]enu_doc (16).doc 31K 
[   ]enu_doc (17).doc 31K 
[   ]enu_doc (18).doc 64K 
[   ]enu_doc (19).doc191K 
[   ]enu_doc (2).doc 38K 
[   ]enu_doc (20).doc 98K 
[   ]enu_doc (21).doc108K 
[   ]enu_doc (22).doc 68K 
[   ]enu_doc (3).doc 53K 
[   ]enu_doc (4).doc760K 
[   ]enu_doc (5).doc1.0M 
[   ]enu_doc (6).doc 60K 
[   ]enu_doc (7).doc637K 
[   ]enu_doc (8).doc568K 
[   ]enu_doc (9).doc 24K 
[   ]enu_picture (1).jpg234K 
[   ]enu_picture (10).jpg680K 
[   ]enu_picture (11).jpg294K 
[   ]enu_picture (12).jpg1.2M 
[   ]enu_picture (13).jpg686K 
[   ]enu_picture (14).jpg838K 
[   ]enu_picture (15).jpg823K 
[   ]enu_picture (16).jpg1.1M 
[   ]enu_picture (17).jpg1.1M 
[   ]enu_picture (18).jpg1.1M 
[   ]enu_picture (19).jpg1.1M 
[   ]enu_picture (2).jpg793K 
[   ]enu_picture (20).jpg1.0M 
[   ]enu_picture (21).jpg954K 
[   ]enu_picture (22).jpg486K 
[   ]enu_picture (23).jpg682K 
[   ]enu_picture (24).jpg756K 
[   ]enu_picture (25).jpg679K 
[   ]enu_picture (26).jpg725K 
[   ]enu_picture (27).jpg600K 
[   ]enu_picture (28).jpg312K 
[   ]enu_picture (29).jpg1.2M 
[   ]enu_picture (3).jpg294K 
[   ]enu_picture (30).jpg209K 
[   ]enu_picture (31).jpg104K 
[   ]enu_picture (32).jpg 97K 
[   ]enu_picture (33).jpg 90K 
[   ]enu_picture (34).jpg101K 
[   ]enu_picture (35).jpg116K 
[   ]enu_picture (36).jpg130K 
[   ]enu_picture (37).jpg105K 
[   ]enu_picture (38).jpg 91K 
[   ]enu_picture (39).jpg116K 
[   ]enu_picture (4).jpg552K 
[   ]enu_picture (40).jpg 96K 
[   ]enu_picture (41).jpg111K 
[   ]enu_picture (42).jpg 98K 
[   ]enu_picture (43).jpg141K 
[   ]enu_picture (44).jpg141K 
[   ]enu_picture (45).jpg139K 
[   ]enu_picture (46).jpg 92K 
[   ]enu_picture (47).jpg121K 
[   ]enu_picture (48).jpg144K 
[   ]enu_picture (49).jpg 99K 
[   ]enu_picture (5).jpg742K 
[   ]enu_picture (50).jpg142K 
[   ]enu_picture (51).jpg125K 
[   ]enu_picture (52).jpg115K 
[   ]enu_picture (53).jpg150K 
[   ]enu_picture (54).jpg 59K 
[   ]enu_picture (55).jpg160K 
[   ]enu_picture (56).jpg189K 
[   ]enu_picture (57).jpg173K 
[   ]enu_picture (58).jpg247K 
[   ]enu_picture (59).jpg285K 
[   ]enu_picture (6).jpg744K 
[   ]enu_picture (60).jpg190K 
[   ]enu_picture (61).jpg197K 
[   ]enu_picture (62).jpg215K 
[   ]enu_picture (63).jpg124K 
[   ]enu_picture (64).jpg169K 
[   ]enu_picture (65).jpg155K 
[   ]enu_picture (66).jpg149K 
[   ]enu_picture (67).jpg155K 
[   ]enu_picture (68).jpg202K 
[   ]enu_picture (69).jpg161K 
[   ]enu_picture (7).jpg771K 
[   ]enu_picture (70).jpg157K 
[   ]enu_picture (71).jpg181K 
[   ]enu_picture (72).jpg114K 
[   ]enu_picture (73).jpg131K 
[   ]enu_picture (74).jpg222K 
[   ]enu_picture (75).jpg189K 
[   ]enu_picture (76).jpg206K 
[   ]enu_picture (77).jpg135K 
[   ]enu_picture (78).jpg196K 
[   ]enu_picture (79).jpg237K 
[   ]enu_picture (8).jpg763K 
[   ]enu_picture (80).jpg175K 
[   ]enu_picture (81).jpg191K 
[   ]enu_picture (82).jpg189K 
[   ]enu_picture (83).jpg239K 
[   ]enu_picture (84).jpg236K 
[   ]enu_picture (85).jpg181K 
[   ]enu_picture (86).jpg230K 
[   ]enu_picture (87).jpg207K 
[   ]enu_picture (88).jpg161K 
[   ]enu_picture (89).jpg232K 
[   ]enu_picture (9).jpg770K 
[   ]enu_picture (90).jpg103K 
[   ]EPIKALYK-FRAZEOLOGIZMDER.pdf146K 
[   ]erzhanov.pdf166K 
[   ]erzhanovaticle.pdf398K 
[   ]Esenberlinnin.pdf220K 
[   ]Esengali S spisokPublikacii.doc 31K 
[   ]EsengaliKuneck.doc204K 
[   ]EsengaliSRSpisokNauchnTrudov.doc 54K 
[   ]Esenova DK_Social'no-politicheskie faktori perenosa stolic na primere nek. zarub. stran.doc 54K 
[   ]Esenova DK_socmodernizaciya v RK.doc 78K 
[   ]ESIMDIKTERDIN-MATIN-UZIMDIK-KYZMETI.pdf165K 
[   ]ESIMSHE-TULGASYNYN-GRAMATIKALYK-KYZMETI.pdf151K 
[   ]ESTABLISHMENT.pdf192K 
[   ]Eszhanova Zh.Zh. Vliyanie ekologicheskoy obstanovki na zabolevaemost' naseleniya RK.doc154K 
[   ]Eszhanova. Cenovaya situaciya kak osnovnaya ugroza.doc103K 
[   ]Eszhanova. Cenovoy mehanizm regulirovaniya prodovol'stvennogo rinka.doc 80K 
[   ]ETIKET.pdf291K 
[   ]etimologicheskoe.pdf268K 
[   ]ETNICHESKIE-MIGRACII.pdf171K 
[   ]ETNICHESKIE-PROCESSY.pdf161K 
[   ]ETNOGENEZ-DUNGAN.pdf323K 
[   ]ETNOLOGIA-GUMILEVA.pdf243K 
[   ]etnologisheskie-osobennosti.pdf150K 
[   ]ETNOSTRATY.pdf307K 
[   ]eurasian_national_university_document (1).pdf1.7M 
[   ]eurasian_national_university_document (10).pdf213K 
[   ]eurasian_national_university_document (100).pdf1.2M 
[   ]eurasian_national_university_document (101).pdf820K 
[   ]eurasian_national_university_document (102).pdf758K 
[   ]eurasian_national_university_document (103).pdf173K 
[   ]eurasian_national_university_document (104).pdf 92K 
[   ]eurasian_national_university_document (105).pdf4.0M 
[   ]eurasian_national_university_document (106).pdf3.4M 
[   ]eurasian_national_university_document (107).pdf 70K 
[   ]eurasian_national_university_document (108).pdf 24K 
[   ]eurasian_national_university_document (109).pdf 98K 
[   ]eurasian_national_university_document (11).pdf115K 
[   ]eurasian_national_university_document (110).pdf 52K 
[   ]eurasian_national_university_document (111).pdf 61K 
[   ]eurasian_national_university_document (112).pdf 84K 
[   ]eurasian_national_university_document (113).pdf 59K 
[   ]eurasian_national_university_document (114).pdf 84K 
[   ]eurasian_national_university_document (115).pdf 62K 
[   ]eurasian_national_university_document (116).pdf 39K 
[   ]eurasian_national_university_document (117).pdf 73K 
[   ]eurasian_national_university_document (118).pdf 34K 
[   ]eurasian_national_university_document (119).pdf 13K 
[   ]eurasian_national_university_document (12).pdf106K 
[   ]eurasian_national_university_document (120).pdf 54K 
[   ]eurasian_national_university_document (121).pdf 77K 
[   ]eurasian_national_university_document (122).pdf 61K 
[   ]eurasian_national_university_document (123).pdf 56K 
[   ]eurasian_national_university_document (124).pdf 25K 
[   ]eurasian_national_university_document (125).pdf 25K 
[   ]eurasian_national_university_document (126).pdf275K 
[   ]eurasian_national_university_document (127).pdf169K 
[   ]eurasian_national_university_document (128).pdf357K 
[   ]eurasian_national_university_document (129).pdf4.1M 
[   ]eurasian_national_university_document (13).pdf4.9M 
[   ]eurasian_national_university_document (130).pdf389K 
[   ]eurasian_national_university_document (131).pdf606K 
[   ]eurasian_national_university_document (132).pdf161K 
[   ]eurasian_national_university_document (133).pdf130K 
[   ]eurasian_national_university_document (134).pdf259K 
[   ]eurasian_national_university_document (135).pdf214K 
[   ]eurasian_national_university_document (136).pdf423K 
[   ]eurasian_national_university_document (137).pdf385K 
[   ]eurasian_national_university_document (138).pdf3.4M 
[   ]eurasian_national_university_document (139).pdf126K 
[   ]eurasian_national_university_document (14).pdf4.9M 
[   ]eurasian_national_university_document (140).pdf126K 
[   ]eurasian_national_university_document (141).pdf144K 
[   ]eurasian_national_university_document (142).pdf144K 
[   ]eurasian_national_university_document (143).pdf151K 
[   ]eurasian_national_university_document (144).pdf162K 
[   ]eurasian_national_university_document (145).pdf117K 
[   ]eurasian_national_university_document (146).pdf474K 
[   ]eurasian_national_university_document (147).pdf226K 
[   ]eurasian_national_university_document (148).pdf129K 
[   ]eurasian_national_university_document (149).pdf166K 
[   ]eurasian_national_university_document (15).pdf1.6M 
[   ]eurasian_national_university_document (150).pdf177K 
[   ]eurasian_national_university_document (151).pdf145K 
[   ]eurasian_national_university_document (152).pdf233K 
[   ]eurasian_national_university_document (153).pdf699K 
[   ]eurasian_national_university_document (154).pdf110K 
[   ]eurasian_national_university_document (155).pdf168K 
[   ]eurasian_national_university_document (156).pdf308K 
[   ]eurasian_national_university_document (157).pdf317K 
[   ]eurasian_national_university_document (158).pdf218K 
[   ]eurasian_national_university_document (159).pdf441K 
[   ]eurasian_national_university_document (16).pdf5.0M 
[   ]eurasian_national_university_document (160).pdf482K 
[   ]eurasian_national_university_document (161).pdf630K 
[   ]eurasian_national_university_document (162).pdf442K 
[   ]eurasian_national_university_document (163).pdf758K 
[   ]eurasian_national_university_document (164).pdf755K 
[   ]eurasian_national_university_document (17).pdf207K 
[   ]eurasian_national_university_document (18).pdf443K 
[   ]eurasian_national_university_document (19).pdf1.5M 
[   ]eurasian_national_university_document (2).pdf2.4M 
[   ]eurasian_national_university_document (20).pdf110K 
[   ]eurasian_national_university_document (21).pdf155K 
[   ]eurasian_national_university_document (22).pdf159K 
[   ]eurasian_national_university_document (23).pdf167K 
[   ]eurasian_national_university_document (24).pdf152K 
[   ]eurasian_national_university_document (25).pdf2.2M 
[   ]eurasian_national_university_document (26).pdf362K 
[   ]eurasian_national_university_document (27).pdf377K 
[   ]eurasian_national_university_document (28).pdf712K 
[   ]eurasian_national_university_document (29).pdf706K 
[   ]eurasian_national_university_document (3).pdf2.4M 
[   ]eurasian_national_university_document (30).pdf140K 
[   ]eurasian_national_university_document (31).pdf196K 
[   ]eurasian_national_university_document (32).pdf129K 
[   ]eurasian_national_university_document (33).pdf163K 
[   ]eurasian_national_university_document (34).pdf687K 
[   ]eurasian_national_university_document (35).pdf216K 
[   ]eurasian_national_university_document (36).pdf682K 
[   ]eurasian_national_university_document (37).pdf243K 
[   ]eurasian_national_university_document (38).pdf213K 
[   ]eurasian_national_university_document (39).pdf152K 
[   ]eurasian_national_university_document (4).pdf1.0M 
[   ]eurasian_national_university_document (40).pdf254K 
[   ]eurasian_national_university_document (41).pdf227K 
[   ]eurasian_national_university_document (42).pdf4.6M 
[   ]eurasian_national_university_document (43).pdf 15M 
[   ]eurasian_national_university_document (44).pdf174K 
[   ]eurasian_national_university_document (45).pdf607K 
[   ]eurasian_national_university_document (46).pdf152K 
[   ]eurasian_national_university_document (47).pdf3.4M 
[   ]eurasian_national_university_document (48).pdf287K 
[   ]eurasian_national_university_document (49).pdf337K 
[   ]eurasian_national_university_document (5).pdf1.9M 
[   ]eurasian_national_university_document (50).pdf187K 
[   ]eurasian_national_university_document (51).pdf436K 
[   ]eurasian_national_university_document (52).pdf3.5M 
[   ]eurasian_national_university_document (53).pdf138K 
[   ]eurasian_national_university_document (54).pdf152K 
[   ]eurasian_national_university_document (55).pdf185K 
[   ]eurasian_national_university_document (56).pdf183K 
[   ]eurasian_national_university_document (57).pdf111K 
[   ]eurasian_national_university_document (58).pdf6.2M 
[   ]eurasian_national_university_document (59).pdf1.3M 
[   ]eurasian_national_university_document (6).pdf864K 
[   ]eurasian_national_university_document (60).pdf209K 
[   ]eurasian_national_university_document (61).pdf169K 
[   ]eurasian_national_university_document (62).pdf377K 
[   ]eurasian_national_university_document (63).pdf 50M 
[   ]eurasian_national_university_document (64).pdf623K 
[   ]eurasian_national_university_document (65).pdf299K 
[   ]eurasian_national_university_document (66).pdf317K 
[   ]eurasian_national_university_document (67).pdf185K 
[   ]eurasian_national_university_document (68).pdf3.0M 
[   ]eurasian_national_university_document (69).pdf243K 
[   ]eurasian_national_university_document (7).pdf221K 
[   ]eurasian_national_university_document (70).pdf 68K 
[   ]eurasian_national_university_document (71).pdf201K 
[   ]eurasian_national_university_document (72).pdf 38K 
[   ]eurasian_national_university_document (73).pdf131K 
[   ]eurasian_national_university_document (74).pdf203K 
[   ]eurasian_national_university_document (75).PDF163K 
[   ]eurasian_national_university_document (76).PDF347K 
[   ]eurasian_national_university_document (77).pdf 39K 
[   ]eurasian_national_university_document (78).pdf 47K 
[   ]eurasian_national_university_document (79).pdf 39K 
[   ]eurasian_national_university_document (8).pdf198K 
[   ]eurasian_national_university_document (80).pdf112K 
[   ]eurasian_national_university_document (81).pdf2.0M 
[   ]eurasian_national_university_document (82).pdf162K 
[   ]eurasian_national_university_document (83).pdf299K 
[   ]eurasian_national_university_document (84).pdf282K 
[   ]eurasian_national_university_document (85).pdf193K 
[   ]eurasian_national_university_document (86).pdf442K 
[   ]eurasian_national_university_document (87).pdf223K 
[   ]eurasian_national_university_document (88).pdf337K 
[   ]eurasian_national_university_document (89).pdf223K 
[   ]eurasian_national_university_document (9).pdf195K 
[   ]eurasian_national_university_document (90).pdf151K 
[   ]eurasian_national_university_document (91).pdf337K 
[   ]eurasian_national_university_document (92).pdf568K 
[   ]eurasian_national_university_document (93).pdf223K 
[   ]eurasian_national_university_document (94).pdf137K 
[   ]eurasian_national_university_document (95).pdf308K 
[   ]eurasian_national_university_document (96).pdf5.0M 
[   ]eurasian_national_university_document (97).pdf157K 
[   ]eurasian_national_university_document (98).pdf293K 
[   ]eurasian_national_university_document (99).pdf159K 
[   ]EURAZIA-KOSHPENDILERI.pdf157K 
[   ]EURODIM 2010. Kr and Xe ion induced aggregation processes in LiF crystals during irradiation and thermal annealing.pdf758K 
[   ]Evaluation-frost-heaving-of-soils-based-in-Astana.pdf911K 
[   ]evolution.pdf.pdf408K 
[   ]evraziistva-teoria-i-praktika.pdf1.0M 
[   ]EVRAZISKAIA-IDEA.pdf219K 
[   ]EVRAZISKOE-PRASTRANSTVO.pdf252K 
[   ]evro.pdf243K 
[   ]EVROSOIUZ.pdf256K 
[   ]EVROZISKOE-ETNOKUL'TURA.pdf141K 
[   ]EVROZISTVO-TRUBECKOGO.pdf277K 
[   ]Exact.pdf386K 
[   ]Examples-of-Equations-of-NavierľStokes-Type-Not-Strongly-Solvable-in-the-Large.pdf561K 
[   ]examples-of-equations.pdf561K 
[   ]exictense.pdf154K 
[   ]Existence- Conditions- for- a- Global Strong.pdf154K 
[   ]Existence-Conditions-for-a-Global-Strong-Solution-to-One-Class-of-Nonlinear-Evolution-Equations-in-a-Hilbert-Space.pdf154K 
[   ]expo-2017.pdf310K 
[   ]EZHELGI-TURKI-ZHANE-KITAI-ORKENIETTERI.pdf278K 
[   ]F.ONGARSYNOVA.pdf164K 
[   ]FacultyofPhy_177_Phenomenological_and_semi-microscopic_analysis_for_16O_and_12C_elastically_scattering_on_the_nucleus_of_16O_and_12C_at_Energies_near_Coulomb_barrier.doc176K 
[   ]FALKLORLYK-PROZA.pdf148K 
[   ]Filologia.pdf3.1M 
[   ]Filosofiya igri v romane Orhana Pamuka źChernaya kniga╗.doc 72K 
[   ]FINANSOVIE ISTOCHNIKI DIVERSIFIKACII KAZAHSTANSKOY EKONOMIKI.doc187K 
[   ]Finansovo-promishlennaya gruppa kak organizacionnaya forma.doc118K 
[   ]fizika-radio..pdf367K 
[   ]fizika.docx295K 
[   ]fizika.pdf367K 
[   ]Fiziko-matem.model' st.proc..jpg397K 
[   ]Fiziko-matem.model' st.proc.1.jpg749K 
[   ]Fiziko-matem.model' st.proc.2.jpg826K 
[   ]Fiziko-matem.model' st.proc.3.jpg947K 
[   ]Fiziko-matem.model' st.proc.4.jpg821K 
[   ]Fiziko-matem.model' st.proc.5.jpg904K 
[   ]Fiziko-matem.model' st.proc6.jpg748K 
[   ]Fiziko-matem.model' st.procPdF.pdf1.1M 
[   ]Fiziko.him.v neorgan.mater..pdf463K 
[   ]flora-prilegaushey-territorii-ozera.pdf253K 
[   ]Fluorescent Chemosensor for Detection and Quantitation of Carbon Dioxide Gas.pdf1.7M 
[   ]FORMIROVANIE.pdf262K 
[   ]formulam-raspredelenia.pdf6.2M 
[   ]formy-proshaniya.pdf215K 
[   ]fpm147.pdf123K 
[   ]fpm976.pdf147K 
[   ]Fractional-Action-Cosmolog-with-Power-Law-Weight-Function.pdf630K 
[   ]FRAZEOLOGOZMDERDIN-KALYPTASUYI.pdf160K 
[   ]fulltext.pdf307K 
[   ]functional-osobennosty-tor-system.pdf217K 
[   ]Functional_Approach.pdf116K 
[   ]funkcional'nost'.pdf191K 
[   ]Fur'e.pdf366K 
[   ]G-essence cosmologies with scalar-fermion.pdf187K 
[   ]G-essence cosmologies.docx103K 
[   ]G-essence with Yukawa interactions.pdf395K 
[   ]G-essence-cosmologies .pdf327K 
[   ]G-essence-cosmologies-with-scalar-fermion-interactions.pdf129K 
[   ]G-essence-cosmologies.pdf327K 
[   ]G-essence-with-Yukaw- interactions.pdf398K 
[   ]G-essesiyadan.pdf5.0M 
[   ]G.docx 14K 
[   ]G.MUSREPOV-SHYGARMALARY.pdf141K 
[   ]G.MUSREPOV-ZHANE-ABAITANU.pdf162K 
[   ]gagea-salisb-tuysyn.pdf234K 
[   ]gai-shan-lin.pdf191K 
[   ]galymdar-murasi.pdf189K 
[   ]garasat-maidani.pdf227K 
[   ]Gasprinskii.pdf235K 
[   ]Gaussian_factor_in_the.pdf182K 
[   ]gazben-jabdyktau.pdf4.8M 
[   ]GEOGRAFIA-I-SREDA-GEOGRAFOV.pdf185K 
[   ]gis-suwnost.pdf346K 
[   ]gistocaykestiliktin-basty-kompleksi.pdf200K 
[   ]gladkost'-i-approksimativnye.pdf326K 
[   ]Gladkost-i-approksimativnie-svoistva-reweni-odnogo-klassa-neleneinih-uravnenii-tipa-wredingera.pdf326K 
[   ]glazyrin-jkh.pdf428K 
[   ]glazyrin.pdf858K 
[   ]GlobalEd.pdf110K 
[   ]gnezdovaya-biology-crechetki.pdf272K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey.jpg647K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey1.jpg449K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey2.jpg753K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey3.jpg875K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey4.jpg1.0M 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey5.jpg817K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey6.jpg655K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey7.jpg561K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey8.jpg416K 
[   ]Gorenie visokoskorostnogo potoka goyuch.gaz.smesey9.jpg1.0M 
[   ]Gotoviy tekst knigi.pdf2.9M 
[   ]grafichekoe-otobrajenie-rasprostranenei-volnovogo-napriajenie-v-sterjne-so-svobodnim-koncom.pdf871K 
[   ]grammatisheskie.pdf182K 
[   ]GUMILEV-ADISNAMASY.pdf227K 
[   ]GUMILEV-Gul'zira apay.doc1.1M 
[   ]Gumilev-kak-myslitel'.pdf188K 
[   ]GUMILEVTYN-EVRAZIAWYLDYK-IDEASY.pdf267K 
[   ]GUMILEVTYN-KAZAK-TARIHYNA-KATYSTY-ZERTTEULERI.pdf237K 
[   ]GUMILEVTYN-PASSIONARLYK-TEORIASY.pdf247K 
[   ]gumilyov-etnogenez.doc1.1M 
[   ]GUMONIZM-I-PSIHOLOGIZM.pdf290K 
[   ]GUN-MEMLEKETININ-TARIHY.pdf155K 
[   ]GUNDAR-TARIXY-TURALY.pdf160K 
[   ]Habarshi (Vestnik). Konceptual'nie osnovi energeticheskoy bezopasnosti.doc234K 
[   ]halkini-bir-kadesine.pdf169K 
[   ]hanskie-yarliki.pdf211K 
[   ]Haos.pdf3.0M 
[   ]Heavy ion induced electron color centers and surface defects of LiF crystals.pdf1.5M 
[   ]HUSRAU-SHYRYN.pdf155K 
[   ]HVD307_Abitova_Ful Paper-Final.docx363K 
[   ]I zvezda s zvezdoyu govorit.docx 36K 
[   ]I.ESENBERLIN.pdf165K 
[   ]ibraev.pdf651K 
[   ]ibrayev-2-jkh.pdf246K 
[   ]ibrayev-2.pdf670K 
[   ]ibrayev.pdf388K 
[   ]ICES J. Mar. Sci.-2008-Gabbasov-103-10.pdf971K 
[   ]ICOM2012BookOfAbstracts.pdf9.4M 
[   ]ICONE14-89028.docx1.6M 
[   ]ICONE14-89028.pdf2.2M 
[   ]IDEA-EVRAZISTVO-PREZIDENTA.pdf248K 
[   ]IDEALOGIA-REAL'NOST'.pdf243K 
[   ]IFI1016.pdf186K 
[   ]im1729.pdf1.7M 
[   ]Imitaciya na personal.komp PdF.pdf418K 
[   ]Imitaciya na personal.komp..jpg561K 
[   ]Imitaciya na personal.komp1.JPG298K 
[   ]Imitaciya na personal.komp3.JPG319K 
[   ]Imitaciya na personal2.JPG540K 
[   ]Influence of pulse electronic irradiation power on processes of F2 centers accumulation in LiF crystals.pdf5.5M 
[   ]Inform.tehn.integr.log..jpg1.9M 
[   ]Inform.tehn.integr.log.1.jpg1.4M 
[   ]Inform.tehn.integr.log.2.jpg1.0M 
[   ]Inform.tehn.integr.log.3.jpg1.6M 
[   ]Inform.tehn.integr.log.4.jpg1.1M 
[   ]Informac.tehn.v logistike PdF.pdf2.0M 
[   ]Informac.tehn.v logistike.jpg648K 
[   ]Informac.tehn.v logistike1.jpg255K 
[   ]Informac.tehn.v logistike2.jpg360K 
[   ]Informac.tehn.v logistike3.jpg655K 
[   ]Informac.tehn.v logistike35.jpg893K 
[   ]Informac.tehn.v logistike4.jpg1.0M 
[   ]Informac.tehn.v logistikePdF.pdf1.0M 
[   ]Informacionnaya shirota Astani.docx 28K 
[   ]informatikany-okytuda.pdf396K 
[   ]informatikany.pdf237K 
[   ]InorgMat1105015LisitsynaLO.pdf117K 
[   ]INOVACIONNYI-OBRAZAVATEL'NYI-KOMPLEKS.pdf239K 
[   ]INP 7th Conference 2009-Page2.jpg1.6M 
[   ]INP 7th Conference Cover 2009-Page1.jpg582K 
[   ]institucionalnye.pdf170K 
[   ]InTech-The_generalized_solutions_of_a_system_of_maxwell_s_equations_for_the_uniaxial_anisotropic_media.pdf487K 
[   ]INTEGRACIA.pdf260K 
[   ]integral model otelbaev M., Sadybekov M.A..pdf2.7M 
[   ]internacionalnye.pdf218K 
[   ]International-Conference-ôMathematical Hydrodynamicsö.PDF619K 
[   ]Interpolation-of-Besov.pdf239K 
[   ]interpretacia-professorom.pdf189K 
[   ]Interv'yu zhurnalu TIME.KZ.doc105K 
[   ]Investigation of 12C + 12C reaction in a wide energy range.pdf106K 
[   ]ion.pdf1.5M 
[   ]iri-kara-mal-leykoz-diagnostikasynda-rekombinanttyk.pdf293K 
[   ]irzherernaya A.RK.PREPRINT ╣21.pdf3.9M 
[   ]ISAAC Otelbaev.pdf1.1M 
[   ]ish'u.pdf270K 
[   ]ishite druzey.docx 38K 
[   ]isledovanie-resursosberegaushih-tehnologii-pri-stroitelstve-i-rekanstrukcii-raspredelitelnih-setei-6-10-kv.pdf422K 
[   ]Isoelectronium_correlations.pdf259K 
[   ]ispaniya_nurahmetov rus.pdf 82K 
[   ]ispaniya_nurahmetov.PDF467K 
[   ]ispitanie grozoy.docx 19K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr.jpg353K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr1.jpg638K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr2.jpg914K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr3.jpg851K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr4.jpg605K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr5.jpg784K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr6.jpg441K 
[   ]Ispo'zovanie metodov imitac.mod.oper.uprav.ra.avt.tr7.jpg743K 
[   ]Ispol'zovanie metodov imitac.mod.oper.uprav.ra.avt.trPdF.pdf1.8M 
[   ]ispol'zovanie-metoda.pdf187K 
[   ]ispolzovanie-rewetok-formalnih-poniatii.pdf654K 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice.jpg2.1M 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice1.jpg399K 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice2.jpg1.1M 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice3.jpg560K 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice4.jpg1.1M 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice5.jpg669K 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice6.jpg767K 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nice7.jpg1.0M 
[   ]Issled.dinamich.param.sharovoy zagr.planet.mel'nicePdf.pdf1.3M 
[   ]issledobanie-processa-sorbcii-neftesoderjashih-stochnih-vod-s-ispolzovaniem-kompazicionnih-materialov.pdf901K 
[   ]ISSLEDOVANIE NERAVNOMERNOSTI RASPREDELENIYa PASSAZHIROPOTOKOV NA METROPOLITENE PDF.pdf241K 
[   ]issledovanie-magnitosoprotivlenia-poluprovodnikov-pri-odnoocnoi-uprugoi-diformacii.pdf801K 
[   ]issledovanie-porogovoi-anomalii-v-rsseinii-6,7Li-na srednih-edriah-na-osnovve-trehchastiuchnoi-modeli.pdf 14M 
[   ]issledovanie-processa-sorbcii-nefti-na-opitno-promishlennoi-ustanovke-i-razrabotka-tehnologicheskoi-shemi-ochistki-vodi-ot-nefti.pdf754K 
[   ]issledovanie.pdf572K 
[   ]issn_1997-2911_2009_2_76.pdf354K 
[   ]Istochniki deviacii v sovremennom kazahstanskom obshestve.doc 48K 
[   ]ISTORICHESKI-FUNDAMENT.pdf235K 
[   ]ISTORII-TIURKSKIH-NARODOV.pdf224K 
[   ]istorisheskii.pdf231K 
[   ]istoriya-razvitiya.pdf504K 
[   ]ivm8128.pdf326K 
[   ]ivm8129.pdf701K 
[   ]iziliktin-tugirindai.pdf194K 
[   ]izmenenie.pdf1.1M 
[   ]IZUCHENIE-EVROPEICAMI-TIURKSKIH-I-MONGOL'SKIH-NARODOV.pdf171K 
[   ]izushenie-martensitnogo.pdf151K 
[   ]izushenie.pdf.pdf557K 
[   ]Izv AN KazSSR ╣5.pdf2.0M 
[   ]Izv AN ╣1.pdf2.8M 
[   ]Izv ╣3.pdf2.6M 
[   ]IZVES.AN.KAZ.SSR ╣1.1983.pdf2.9M 
[   ]IZVES.AN.KAZ.SSR ╣1.pdf2.5M 
[   ]IZVES.AN.KAZ.SSR ╣5.pdf2.4M 
[   ]Izvestie vuzov.pdf5.4M 
[   ]Izvestiya NAN 5.pdf2.8M 
[   ]Izvestiya ╣3.pdf4.2M 
[   ]Izvestiya. Ocenka radiusa treka tyazhelih zaryazhennih chastic v ionnih kristalah po spektam navedennogo poglosheniya.pdf287K 
[   ]IZVESTIYa.AN.RK ╣3.pdf6.3M 
[   ]jalkenovarole-part-2013.doc 47K 
[   ]jalkenovarole-part2-2013.doc 57K 
[   ]jana.pdf241K 
[   ]Janar_Scopus.jpg286K 
[   ]janinda-kim-jurgenin.pdf223K 
[   ]jasimizda-jattadyk.pdf168K 
[   ]jasyl-ekonomika.pdf253K 
[   ]jaz-kitapy.doc 23K 
[   ]jazushi-jane-korkemdik-shyndyk.pdf420K 
[   ]jazushi-tursin-jurtbai.pdf216K 
[   ]jazushi.pdf215K 
[   ]jmi-02-50.pdf209K 
[   ]jol-ustindegi-oi.pdf203K 
[   ]Journal of US-China Public Administration.pdf 72K 
[   ]jumagulov.pdf1.2M 
[   ]jumaldihanov.doc 69K 
[   ]jurnakhtar.pdf226K 
[   ]jurnalistskoe.pdf176K 
[   ]jurtty-suigen-jurtpai.pdf231K 
[   ]justification.pdf123K 
[   ]JUXTAPOSITION.pdf188K 
[   ]K voprosu o perspektivah molodezhnoy politiki v Kazahstane.doc 63K 
[   ]K voprosu repatriacii v Kazahstane.doc 46K 
[   ]k voprosu.pdf188K 
[   ]K-assimptoticheskim-formulam-sobstvennih-chisel-operatora-wturma-luivilla.pdf2.6M 
[   ]k-formulam-raspredeniya.pdf377K 
[   ]k-metodu-tichmarsha.pdf3.7M 
[   ]K-modelirovaniu-himicheskogo-i-radioaktivnogo-zagreznenie-poverhnosti-zemli-pri-ispitanii-visokoenergeticheskih-ustroistv.pdf134K 
[   ]K-teoremam-o-kompaknosti.pdf1.1M 
[   ]k-teoremam-o-kompaktnosti.pdf4.9M 
[   ]K-teorii-eriziommogo-gorenie-tverdih-raketnih-topliv.pdf302K 
[   ]K-viesneniu-prirodi-koncentracionnogo-predela-gorenie.pdf369K 
[   ]K-voprosu-nahojdenie-postaiannoi-Markwteina.pdf100K 
[   ]k-voprosu-o-pon9tii.pdf239K 
[   ]k-voprosu-obespechenia.pdf242K 
[   ]k-voprosu.pdf382K 
[   ]K?l│k logistikasi o?u ??rali.jpg100K 
[   ]K?l│k logistikasi o?u ??rali1.jpg109K 
[   ]K?l│k logistikasi o?u ??rali2.jpg274K 
[   ]K?l│k logistikasi o?u ??raliPdF.pdf528K 
[   ]kaf_psihologiya.ppt153K 
[   ]kairimnin-murasi.pdf279K 
[   ]kalamger-jane-koltanba.pdf207K 
[   ]KALAMGER-WYGARMASY.pdf158K 
[   ]Kaldibaeva O.V. 1.doc 64K 
[   ]Kaldibaeva O.V. 2.doc 60K 
[   ]Kaldibaeva O.V. 3.doc 45K 
[   ]Kaldibaeva O.V. 4.doc 57K 
[   ]Kaldibaeva O.V. 5.doc 55K 
[   ]Kaldibaeva O.V. 6.doc 44K 
[   ]Kaldibaeva O.V. 7.doc 53K 
[   ]Kaldibaeva O.V. 8.doc 49K 
[   ]kalkeeva-zar.doc221K 
[   ]Kamarova.docx5.7M 
[   ]karapaim.pdf190K 
[   ]karimov.pdf1.3M 
[   ]karjylyk.pdf160K 
[   ]karkaraly-memlekettik-ylltyk-tabigi.pdf212K 
[   ]KARLAG.pdf240K 
[   ]KASACHISCHER VEKTOR DER CHINESISCHEN MIGRATION.doc437K 
[   ]KASIBI-SOZDER.pdf159K 
[   ]kasiporyndagy.pdf173K 
[   ]Kassymbekova.docx5.2M 
[   ]Kategoriya nakloneniya kak yavlenie i sredstvo virazheniya diskursa.doc2.4M 
[   ]KAZAH-I-KAZAK.pdf246K 
[   ]KAZAHSKAYa NACIONAL'NAYa INTELLIGENCIYa I PETICIONNOE DVIZHENIE KAZAHOV.doc 49K 
[   ]Kazahstanskiy podhod k proektir.seti trans-log.centrovPdF.pdf3.1M 
[   ]KAZAHSTANSKIY VEKTOR KITAYSKOY MIGRACII.doc451K 
[   ]KAZAHS~1.DOC354K 
[   ]KAZAK-ADEBIETI.pdf155K 
[   ]kazak-agylshyn.pdf283K 
[   ]kazak-bileri.pdf294K 
[   ]KAZAK-HALYK-ERTEGILERI.pdf145K 
[   ]kazak-tili.pdf305K 
[   ]KAZAK-TILIN-OKYTUDYN-MASELELERI.pdf157K 
[   ]KAZAK-TILINDEGI-KURDELI-ETISTIKTER.pdf155K 
[   ]kazakh-adebietindegi.pdf181K 
[   ]kazakh-antroponomiyasy.pdf172K 
[   ]kazakh-eskilikterindegi.pdf164K 
[   ]kazakh-fantastika.pdf187K 
[   ]kazakh-prozasyndagy.pdf178K 
[   ]kazakh-tanymyndagy.pdf203K 
[   ]kazakh-tili-adistemelik.pdf1.8M 
[   ]kazakh-toponimderi.pdf212K 
[   ]kazakh-turki.pdf290K 
[   ]kazakh.pdf215K 
[   ]kazakhsha-sozdik.pdf242K 
[   ]kazakhskie-ekvivalenty.pdf202K 
[   ]Kazakhstan-i-Lev-Gumilev.pdf241K 
[   ]kazakhstan-respublikasi.pdf139K 
[   ]kazakhstan-respublikasyndagy.pdf160K 
[   ]kazakhstanda.pdf198K 
[   ]kazakhstandagy-dini.pdf175K 
[   ]kazakhstandagy-innovaciyalyk.pdf154K 
[   ]kazakhstandagy.pdf305K 
[   ]kazakhstano-kitaiskoe.pdf195K 
[   ]kazakstan-territoriyasynda-taralfan-mtuberculosis.pdf195K 
[   ]kazakstandagy-yuvenaldyk.pdf286K 
[   ]KazGNU.pdf8.5M 
[   ]KAZIRGI-KAZAH-ZHANUE-TURKI-TILINDEGI-SEPTIK.pdf211K 
[   ]kazirgi-kazak.pdf301K 
[   ]kazirgi-kazakh.pdf200K 
[   ]kazirgi-kezendegi.pdf158K 
[   ]kazirgi-mazharstan.pdf210K 
[   ]kazirgi-postmodernistik.pdf198K 
[   ]kazirgi.pdf208K 
[   ]KazNu Conference Book.pdf6.7M 
[   ]kebet.doc 19M 
[   ]keipker-prihologiasi.pdf276K 
[   ]Kelvin-Voigt-suigi-uwin-jilu-konvekcia-tendulerinin-bir-e-juiktaui-jane-onin-jinaktalu-jildamdigi.pdf578K 
[   ]kemerovo 2004_Nurahmetov.pdf512K 
[   ]KEMPIR-NEBESNOE-BOZHESTVO.pdf253K 
[   ]KEYIPKER-TILININ-UYMDASUYI.pdf186K 
[   ]KHAZAR-ARHELOGY.pdf179K 
[   ]Kir.GNU.pdf1.5M 
[   ]kirgiz 201.pdf1.3M 
[   ]KirGNU.pdf1.5M 
[   ]KITAI-HALKYNYN-DUNIE-TANYMY.pdf249K 
[   ]kitap-bul-tehnologialik.pdf199K 
[   ]kitaphana-kuttyktayu.pdf281K 
[   ]kitaptar-kazinasi.pdf189K 
[   ]kniga.pdf868K 
[   ]kodirovanie-ciklisheskix.pdf236K 
[   ]kodirovanie.pdf241K 
[   ]KOK-TUSTI-FRAZEOTIRKESTER.pdf163K 
[   ]kommunikativtik.pdf266K 
[   ]KOMPIUTERLIK-TEHNOLOGIA.pdf158K 
[   ]Kompjuternyj.pdf4.8M 
[   ]Komponenti-efirnogo-masla-NEPETA-Pannonical-flori-kazakstana.pdf681K 
[   ]komputernaya_lecs_v_rusle.pdf212K 
[   ]Kon.Elektronnaya.pdf414K 
[   ]Konakova.pdf3.1M 
[   ]koncept-molshaniya.pdf200K 
[   ]koncept.pdf252K 
[   ]KONCEPTUAL'NYE-PROBLEMY.pdf244K 
[   ]Kondratjev.Atmosfernyj.pdf5.7M 
[   ]KONE-TURKI-ZHAZBA-ESKERTKISHTERI.pdf155K 
[   ]KONE-TURKI-ZHAZBALARY.pdf176K 
[   ]kone-turki.pdf203K 
[   ]konedegi-korkem.pdf360K 
[   ]KONERGEN-SOZDER.pdf149K 
[   ]Konev.Fotobiologija.pdf4.0M 
[   ]Konf.Tomsk.pdf1.1M 
[   ]KONIL-KUY-ETISTIKTERI.pdf179K 
[   ]Konkurenciya i monopoliya antogonizm i sintez.doc492K 
[   ]Kononovich.pdf3.5M 
[   ]KONSEPCII-EVROZISTVO.pdf284K 
[   ]KONSEPCII-L.N.GUMILEV.pdf142K 
[   ]KonspLekcOkonch_2012.doc362K 
[   ]konstitutsiya.pdf1.0M 
[   ]konstruksionnye.pdf1.8M 
[   ]KontrVoprLiterSoderOkonchat.doc258K 
[   ]KONYR-SOZININ-ASHYLUYI.pdf192K 
[   ]kopkabatty.pdf283K 
[   ]KORKEM-ADEBIET-TILINDEGI-KIRME-SOZDER.pdf164K 
[   ]korkem-metindegi.pdf220K 
[   ]KORKEM-SOZ-ZHANE-PRAGMATIKA.pdf155K 
[   ]Korlan Islamovna.docx 77K 
[   ]Kornishin.pdf4.0M 
[   ]Korobeinikov.pdf2.5M 
[   ]Korolkov.pdf1.7M 
[   ]Korolyov.pdf3.1M 
[   ]korrelyacialyk-geokosmostyk-taueldilikti.pdf790K 
[   ]korroziya.pdf1.5M 
[   ]korrupciya.pdf327K 
[   ]Kosanov.pdf 11M 
[   ]Kosticyn.Evoljucija.pdf1.0M 
[   ]Kostrikin.pdf3.9M 
[   ]Kotkin.pdf1.8M 
[   ]Kovancov.pdf9.8M 
[   ]KOWPENDILERDIN-SHEKARALYK-STRATEGIASY.pdf182K 
[   ]Kozel.pdf4.6M 
[   ]KOZGALYS-MANDI-ETISTIKTER.pdf162K 
[   ]Kozlov.pdf1.7M 
[   ]Kozlov_bil.pdf3.1M 
[   ]Kozlov_stat.pdf4.0M 
[   ]Kozlov_ver.pdf4.7M 
[   ]KR-da.pdf173K 
[   ]Kramer.pdf 13M 
[   ]Krasnov.pdf1.8M 
[   ]Krasnov5.pdf4.8M 
[   ]Kratkoe opisanie.doc 23K 
[   ]Kremlevskii.pdf9.7M 
[   ]kreterii.pdf624K 
[   ]kriptografiya1.pdf4.0M 
[   ]kriptografiya2.pdf 10M 
[   ]Kristofides.pdf7.8M 
[   ]Kriterii-iadernosti-rezolventi-operatira-Wturma-Liuvilla.pdf104K 
[   ]Kriterii-lipwicebosti-snijaemosti-neleneinih-integralnih-operatorov.pdf2.3M 
[   ]kriterri-yadernosti.pdf1.9M 
[   ]Krivoshapko.pdf3.3M 
[   ]Kronin.pdf3.3M 
[   ]Kronover.pdf1.2M 
[   ]Krotov.pdf2.2M 
[   ]krtptografiya3.pdf8.4M 
[   ]krtptografya4.pdf 12M 
[   ]krtptografya5.pdf7.9M 
[   ]Krushevskii.pdf2.1M 
[   ]Kuandikov.pdf1.1M 
[   ]Kubo.pdf3.1M 
[   ]Kudrjashov.Osnovy.pdf4.9M 
[   ]Kudryavtsev1.pdf7.7M 
[   ]Kudryavtsev2.pdf5.9M 
[   ]Kufner.pdf3.5M 
[   ]KUL'TURNYI-ASPECT.pdf247K 
[   ]Kulak.pdf3.0M 
[   ]Kulanda Erjanova.pdf470K 
[   ]Kulekeev D.B. Problemy stabilizacii bankovskoi sistemy Respubliki Kazahstan.pdf1.9M 
[   ]Kulikpaeva.pdf 11M 
[   ]Kupershmidt.pdf5.1M 
[   ]kurandagy flora.pdf518K 
[   ]Kurant1.pdf6.7M 
[   ]Kurant2.pdf8.6M 
[   ]Kuratovskii1.pdf 10M 
[   ]kurban-2008.pdf2.5M 
[   ]kurmanuli O.pdf574K 
[   ]Kurosh.pdf4.1M 
[   ]Kurs obshchej himii.pdf3.6M 
[   ]KUSAINOV.pdf1.3M 
[   ]kusainova.pdf1.0M 
[   ]kusainovtin-kuttyktayu.pdf317K 
[   ]kushtarliktin-kurbany.pdf178K 
[   ]kuttyktau-soz.pdf172K 
[   ]Kuzmenko.Himija 2400 zadach.pdf6.2M 
[   ]Kuzmenko.Himija.pdf5.4M 
[   ]Kuznecov.pdf3.5M 
[   ]Kvakernaak.pdf8.3M 
[   ]Kvant.him Astana.pdf203K 
[   ]Kvant.pdf1.3M 
[   ]KVANTOVO-HIMICHESKOE ISSLEDOVANIE OPREDELENIYa CENTRA.pdf112K 
[   ]KYTAI-JYLNAMALARYNDAGY-KAZAH TARYHY.pdf236K 
[   ]kz_kuran.pdf3.0M 
[   ]L.Z.Bisenova Problemy metodologicheskogo obespecheniya finansovogo kontrolya.pdf550K 
[   ]Ladigenskaya.pdf6.6M 
[   ]Lagutin.pdf146K 
[   ]Lamb.pdf 15M 
[   ]Lampert.pdf4.5M 
[   ]Landau-Drobanceva.pdf6.3M 
[   ]Landau.pdf1.2M 
[   ]Landi.pdf 18M 
[   ]Landsberg1.pdf 14M 
[   ]Landsberg2.pdf 11M 
[   ]Landsberg3.pdf 15M 
[   ]Lange_exp.pdf1.1M 
[   ]Lange_paradox.pdf2.1M 
[   ]Lansberg.pdf6.3M 
[   ]Lapovok.pdf1.7M 
[   ]Lapp.Iskusstvo.pdf4.4M 
[   ]last.doc 24K 
[   ]Latitude-Effect.pdf156K 
[   ]latyn-grafikasy.pdf264K 
[   ]lavr12-20121007.pdf3.4M 
[   ]Lavrov.pdf3.7M 
[   ]lec20_olander3.pdf4.9M 
[   ]Lefshets.pdf 64M 
[   ]legal.pdf172K 
[   ]Lekah.Kljuch.pdf4.4M 
[   ]lemma13.pdf 97K 
[   ]Leng.pdf9.7M 
[   ]Leslie.Nuclear.pdf 31M 
[   ]Levi-Chivita1-1.pdf 12M 
[   ]Levi-Chivita1-2.pdf6.2M 
[   ]Levi-Chivita2-1.pdf7.9M 
[   ]Levi-Chivita2-2.pdf 10M 
[   ]Levi.Iskusstvo-1.pdf3.7M 
[   ]Levi.Kuda.pdf7.3M 
[   ]Levi.Naemnyj.pdf7.8M 
[   ]Levi.Nestandartnui.pdf3.2M 
[   ]Levi.Ohota.pdf3.2M 
[   ]Levi.Vezet.pdf2.7M 
[   ]Levit.Biogeochemistry.pdf3.7M 
[   ]Lichniy listok.pdf1.2M 
[   ]LICHNOST'-ATILLY.pdf175K 
[   ]Lidovskii.pdf889K 
[   ]Lifshic.pdf 14M 
[   ]Lifshic_met.pdf8.3M 
[   ]Lighthill.pdf9.6M 
[   ]Lihnerovich.pdf3.3M 
[   ]Likerova-Nurmanova.pdf720K 
[   ]Liliental.pdf1.3M 
[   ]Lindblad.Chelovek.pdf1.3M 
[   ]LINEAR MINIMAL RINGS AND ALGEBRAS.pdf711K 
[   ]LINGUA.pdf233K 
[   ]Lipophilic-fractions-components-of-Artemisia-annua-L..pdf2.4M 
[   ]lishnost.pdf272K 
[   ]listinfo.docx 26K 
[   ]Littleton.pdf1.0M 
[   ]Litvinov - ++++++++.pdf5.0M 
[   ]Loev.pdf 10M 
[   ]LOGISTICHESKAYa SISTEMA PASSAZHIRSKIH PEREVOZOK Pdf.pdf223K 
[   ]LOGISTICHESKIE OSNOVI UPRAVLENIYa INFRASTRUKTUROY.doc 81K 
[   ]Logistika i tovarno-upak.proizv.za rub.jpg806K 
[   ]Logistika i tovarno-upak.proizv.za rub1.jpg893K 
[   ]Logistika i tovarno-upak.proizv.za rubPdF.pdf550K 
[   ]LOGISTIZACIYa PASSAZHIRSKIH PEREVOZOK Pdf.pdf212K 
[   ]Logunov.pdf6.3M 
[   ]lokalizovannaya.pdf617K 
[   ]Lomonosov.pdf5.4M 
[   ]Lorenc_lekc.pdf696K 
[   ]Lorenc_stat.pdf730K 
[   ]Lorenzo.pdf6.8M 
[   ]Lower-and-Upper.pdf163K 
[   ]lt4.pdf1.0M 
[   ]Lubich.pdf678K 
[   ]Lubitel'skoe.pdf2.2M 
[   ]Lukjanchikova.pdf4.0M 
[   ]Lunc.pdf4.3M 
[   ]Lurie.pdf1.5M 
[   ]Lurie_nonlin.pdf6.8M 
[   ]Lurie_upr.pdf 13M 
[   ]Lutmanov.pdf3.0M 
[   ]Lyahovskii.pdf7.2M 
[   ]Lyuminesc.vozn.pri rekomb.naveden.def.pdf463K 
[   ]M.docx 27K 
[   ]M.Joldasbekov Bugingi turkologiyanin ozekti maseleleri.pdf863K 
[   ]M.Otelbaev gilim joli tandau men talap.pdf2.7M 
[   ]Maclein.pdf7.6M 
[   ]MacVitti.pdf4.0M 
[   ]Madelung_phys.pdf2.9M 
[   ]Madelung_theor.pdf4.8M 
[   ]madeni mura.pdf1.3M 
[   ]MADENI-MURA.pdf269K 
[   ]madeniet-mura.pdf317K 
[   ]madenietaralyk-bailanys.pdf256K 
[   ]Madiyarova E.docx 26K 
[   ]Magauinnin.pdf223K 
[   ]Magnetic_Freezing.pdf201K 
[   ]Magneto-optical-properties.pdf291K 
[   ]Magneto-optics-of-quantum.pdf147K 
[   ]Magneto-optics.pdf158K 
[   ]magnitometric.pdf.docx686K 
[   ]magnitometric.pdf.pdf191K 
[   ]Mah_lekcii.pdf759K 
[   ]Mah_mehanika.pdf3.1M 
[   ]Makarov.Extremal.pdf1.0M 
[   ]Makarov.pdf3.7M 
[   ]Makhmetova.pdf115K 
[   ]Makimbaeva.pdf1.0M 
[   ]maksimkin.docx345K 
[   ]Maksimov.pdf 10M 
[   ]Maksutov.Anaberracionnoe.pdf3.5M 
[   ]Maksutov.Astronomicheskaja.pdf7.8M 
[   ]Maksutov.Izgotovlenie.pdf 10M 
[   ]Maksutov.Novye.pdf4.3M 
[   ]Maksutov.Opticheskie.pdf2.0M 
[   ]Maksutov.Tenevye.pdf3.0M 
[   ]Maksvell.pdf781K 
[   ]Malibaeva Korkem shigarmanin.pdf537K 
[   ]Malinin.pdf5.1M 
[   ]Malkin.pdf5.5M 
[   ]Mamadzhunussova.pdf113K 
[   ]Mamaeva G.B. Terminjasamnin marfologiyalik tasili.pdf802K 
[   ]Mamaeva G.B.Terminjasamnin analitikalik tasili.pdf1.4M 
[   ]Mamaeva G.B.Tirkesti terminderdin kuramy.pdf1.2M 
[   ]Mambetov.pdf176K 
[   ]Mandelshtam.pdf6.2M 
[   ]mangilik-sogis.pdf198K 
[   ]mangol-dauirindegi.pdf220K 
[   ]Manin.pdf1.9M 
[   ]Maradudin.pdf3.6M 
[   ]Marchenko.pdf3.6M 
[   ]Markov.pdf9.1M 
[   ]Marmontova T.V. Vzaimodeistvie yujnoi Korei i Kazahstana v sfere ekonomiki.pdf497K 
[   ]Marri.Nelinejnye.pdf5.2M 
[   ]Marshall.pdf9.4M 
[   ]Masimhanuli D. Lu-Shun jane Kytaidin dasturli madenieti.pdf1.2M 
[   ]Maslov.pdf2.6M 
[   ]Maslov_teor.pdf1.8M 
[   ]Mat. zametki T.20, Vip ╣6.pdf6.8M 
[   ]Mat. zametki T.29 Vip.6.pdf3.1M 
[   ]Mat. zhur. Almati,tom 4,╣2(12) UDK 681.324.pdf4.6M 
[   ]Mat. zhur. Almati,tom 4,╣4(14) UDK 681.324.pdf1.6M 
[   ]Mat.issl. Vip ╣3.pdf 15M 
[   ]Mat.issl.-Vip ╣4.pdf 21M 
[   ]Mat.zametki T.20.Vip 6.pdf4.5M 
[   ]Matem.zametki tom 53.pdf3.8M 
[   ]Matematicheskaja.pdf3.3M 
[   ]Matematicheskaya gidrodinamika, Moskva 2006.pdf932K 
[   ]Matematika.pdf1.6M 
[   ]MaterialsLetters full-Arman.pdf362K 
[   ]math01_2008.pdf1.0M 
[   ]mathcad.pdf396K 
[   ]matimaticheskaia-model-agregacii-v-sisteme-s-himicheskoi-reakcei-vtorogo-poriadka.pdf535K 
[   ]Mattis.pdf6.2M 
[   ]Maulenov.pdf202K 
[   ]mausinbayevanin-kuttyktayu.pdf214K 
[   ]Maxambet.pdf188K 
[   ]maximkin_2008_2.docx 94K 
[   ]Mead.Linus.pdf4.7M 
[   ]mechanisms.pdf284K 
[   ]mechanizm.pdf777K 
[   ]meh.pered.energ.primesyami v sint.krist..pdf193K 
[   ]Mejdunarodnaja.pdf6.4M 
[   ]Meledin.pdf4.6M 
[   ]Meller.pdf6.5M 
[   ]memlekettik.pdf174K 
[   ]Menlibekova-Baidrahmanov.pdf1.2M 
[   ]Merfi.pdf3.4M 
[   ]Merkin.pdf 13M 
[   ]Meshkov1.pdf3.5M 
[   ]Meshkov2.pdf4.4M 
[   ]Messia1.pdf6.6M 
[   ]MESTO-PRIRODNY-SREDY.pdf165K 
[   ]met.ocenk.kon.radionuklidov.pdf179K 
[   ]METHOD.pdf189K 
[   ]Methods of overcoming of financial crises.doc 55K 
[   ]methods.pdf138K 
[   ]Methods_tool_and_class_activities_in_the_teaching_process.pdf226K 
[   ]Metod-fiktovnih-oblasti-dlia-sektralnoi-zadachi-operatora-Stoka.pdf192K 
[   ]metod.docx 76K 
[   ]metod.pdf277K 
[   ]metodika-ispitanii-gruntov-Spring-Hummer-Rapid-Load-Test-testirovanie-za-korotkoi-promejutok-vremeni-prujinnom-molotom.pdf1.2M 
[   ]metodika-rascheta-obratnoi-sviazi-po-skorostoi-elektroprivoda-s-chastotnim-preobrazovatelem.pdf803K 
[   ]metodika.pdf419K 
[   ]Metodologicheskie problemi novoy informacionnoy ekonomiki.doc 94K 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt.jpg1.1M 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt1.jpg1.1M 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt2.jpg834K 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt3.jpg1.0M 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt4.jpg685K 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt5.jpg788K 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt6.jpg664K 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avt7.jpg317K 
[   ]Metodologichseskie osnovi upr.obsluzh.remontom avtPdF.pdf1.2M 
[   ]METODOLOGIYa FORMIROVANIYa EDINOY INTEGRIROVANNOY.doc106K 
[   ]Metody obshchej.T.1.pdf4.8M 
[   ]Metody obshchej.T.2.pdf4.5M 
[   ]Metody obshchej.T.3.pdf3.1M 
[   ]metody-analiza-na-vyyavleniya-toksoplamoza.pdf278K 
[   ]Mezh.konf. Primenenie teorem vlozheniya.pdf693K 
[   ]MgF2.pdf152K 
[   ]microgravitation-jagdayinda-tomengi.pdf207K 
[   ]MIFOLOGIA-I-RELIGIA.pdf188K 
[   ]mifopoetikalyk.pdf228K 
[   ]Migdal.pdf4.9M 
[   ]MIGRACIONNIE PROCESSI V RESPUBLIKE KAZAHSTAN V 1990-E GODI.doc 34K 
[   ]MIGRATION DER ETHNISCHEN KASACHEN IN IHRE HISTORISCHE HEIMAT.doc489K 
[   ]MIGRATION OF ETHNIC KAZAKHS TO HISTORICAL NATIVE LAND.doc 31K 
[   ]MIGRATIONSPROZESSE IN KASACHSTAN IN DEN 90ER JAHREN.doc 30K 
[   ]Mihelson.Optica.pdf4.2M 
[   ]Mihelson.Opticheskie.pdf 16M 
[   ]mikrofizisheskie.pdf498K 
[   ]Mikusinskii2.pdf671K 
[   ]Milne-Thomson.pdf 12M 
[   ]Milnor.pdf3.4M 
[   ]Milnor1.pdf4.9M 
[   ]Mishel.pdf3.7M 
[   ]Mishkis.pdf 10M 
[   ]Mitchell.pdf2.2M 
[   ]Mizamova_rol'_mestnih_byudzhetov.docx361K 
[   ]Mizner1.pdf7.6M 
[   ]Mizner2.pdf9.7M 
[   ]Mizner3.pdf9.8M 
[   ]mmo399.pdf2.2M 
[   ]mnogoparametri4eskii.pdf326K 
[   ]MODALITY.pdf218K 
[   ]model-vzaimodeistviya.pdf278K 
[   ]MODELING ALLOCATION OF PARALLEL.pdf580K 
[   ]modelirivane-akusticheskih-neustoichivosti-v-kamere-raketnogo-dvigatelia-tverdogo-topliva.pdf167K 
[   ]Modelirovanie nanorazmernih deiektov v kristale KBr.pdf 0  
[   ]Modern Physics E.pdf279K 
[   ]modernizaciya.pdf260K 
[   ]Modified Chaplygin gas and solvable F-essence cosmologies.pdf460K 
[   ]Modified Chaplygin.docx404K 
[   ]Modified-Chaplygin-Gas-and-Solvable-F-essence-Cosmologies.pdf233K 
[   ]Modified-Chaplygin.pdf457K 
[   ]MODUL'DIK-OKYTU.pdf146K 
[   ]Mogen.pdf7.7M 
[   ]molibdofermenty-i-ih-biologycal-rol.pdf228K 
[   ]Mominbekova.pdf 11M 
[   ]Monastirskii.pdf6.8M 
[   ]Mongoliya 2006.pdf433K 
[   ]mongoltanu-shenberinde.pdf183K 
[   ]Monografiya Abzhapparova.docx552K 
[   ]Monopolisticheskiaya vlast' v sisteme vlastnih otnosheniy.doc 78K 
[   ]MORDOVSKI-ETNOS.pdf164K 
[   ]Mosolov.pdf4.5M 
[   ]Moss.What Genes.pdf543K 
[   ]Mosteller.pdf5.9M 
[   ]MOVZOLEI-BERDIKOZHA-BATYR.pdf802K 
[   ]Mozer.pdf2.0M 
[   ]MSc_WL-45h.pdf185K 
[   ]mt52.pdf1.5M 
[   ]mtor-kompleksterin.pdf245K 
[   ]Mueller.Fundamentals.pdf6.0M 
[   ]Muhambetova Imanbekova.pdf269K 
[   ]Muhambetova-2.pdf217K 
[   ]Muhambetova.pdf626K 
[   ]Muhametjanova Povsed.pdf1.1M 
[   ]Muhtarhanova.pdf1.2M 
[   ]Mukasheva.pdf 92K 
[   ]mukhambetova.pdf316K 
[   ]Mulen.pdf2.5M 
[   ]Mun.pdf4.7M 
[   ]Murphy.Protein.pdf1.7M 
[   ]Murtazanyn.pdf171K 
[   ]MusabaevaAB_12(1).doc 71K 
[   ]Musagalieva Kenes.pdf1.2M 
[   ]Musagalieva.pdf1.3M 
[   ]Musalimov Formirovanie.pdf569K 
[   ]Musalimov I T.pdf 11M 
[   ]musalimov.pdf2.1M 
[   ]Musina.pdf109K 
[   ]MUSTAFA SHOKAY O PROBLEMAH FINANSOVO.doc 41K 
[   ]Mustafin S.A..pdf483K 
[   ]Mustafina Mechety.pdf753K 
[   ]MUZTAU-UKOK(ALTAI).pdf258K 
[   ]My Nuclear Physics A.pdf593K 
[   ]My Physica Scripta (1).pdf423K 
[   ]My Physica Scripta.pdf423K 
[   ]myrzakhmet.pdf422K 
[   ]mysyr-orkenietinin.pdf170K 
[   ]MZ-2011-V89-╣5.pdf455K 
[   ]mzm10032.pdf104K 
[   ]mzm1135.pdf248K 
[   ]mzm1687.pdf262K 
[   ]mzm190.pdf212K 
[   ]mzm2389.pdf407K 
[   ]N.Omashev tortinshi bilik.pdf2.1M 
[   ]n.p.albitov Kazak agartushilari enbekterin konfessionaldi tarbiede paidalanu.pdf546K 
[   ]NAB.pdf 82K 
[   ]Nac. Duh i process.doc 94K 
[   ]nacionalnyi-duh.pdf245K 
[   ]nacionalnyi.pdf191K 
[   ]Nagirner.pdf768K 
[   ]Nahojdenie-uslovii-diffuzionno-teplovoi-ustoichivosti-plameni-s-primeneniem-modelnoi-funkcii-skorosti-himicheskoi-reakcii.pdf134K 
[   ]Nakipbaeva Zh.A..doc 52K 
[   ]Namestnikov.pdf3.3M 
[   ]Narasimhan.pdf3.1M 
[   ]Narusberg.pdf3.1M 
[   ]Narushenie zakona obratimosti vo ftoride litiya, obluchennogo ionami ksenono i azota.pdf1.8M 
[   ]NASELENIE-ZAPADNOI-SIBIRI.pdf195K 
[   ]Nasihat.pdf 45M 
[   ]Nasledie Ch.Ch. Valihanova v kontekste mirovoy istorii.doc1.7M 
[   ]Nasledie K.I. Satpaeva i perspektivi Ulitau-Zhezkazganskogo regiona.doc402K 
[   ]NASLEDIE-ZAPADNOGO-TIURKSKOGO-KAGANATA.pdf172K 
[   ]NASLEDII-PLATONOVA.pdf232K 
[   ]Naubat Kaliev. Tauelsiz Kazakstannin sayasi juiesi sapalik ozgerister.pdf946K 
[   ]nauchnaya publikaciya Gulim Dosanovoy , sociologiya ,ENU.doc 38K 
[   ]NAUCHNO-FILOSOFSKAIA-INTERPRETACIA.pdf299K 
[   ]NAUCHNYE-NASLEDIA-GUMILEVA.pdf237K 
[   ]NAURYZ-MEIRAMY.pdf157K 
[   ]nauryz-shygys.pdf277K 
[   ]Navashin.Teleskop.pdf7.3M 
[   ]Nazaikinskii.pdf1.6M 
[   ]Nazarbayev_90-91.pdf 10M 
[   ]Nazarov.pdf5.0M 
[   ]ne dayte pamyati zasnut'.docx 21K 
[   ]Nechaeva.pdf516K 
[   ]Negimov S.pdf4.5M 
[   ]nekotorye-osobennosti.pdf261K 
[   ]nekotorye-osobennosty-cistanche.pdf193K 
[   ]Nelok.ocenki.pdf8.6M 
[   ]NEMCY-BASHKORTOSTANA.pdf126K 
[   ]Nemitskiy.pdf8.2M 
[   ]NEOLOGIZMDER.pdf155K 
[   ]Nepeta nuda L..pdf675K 
[   ]neracionalnoe-useful-water-resources-of-kazakhstan.pdf186K 
[   ]Nesipbai R.T. Ispolzovanie teologicheskih osnov Hanafitskogo mazhaba v protivodeistvii religionomu ekstremizmu i terrorizmu. K postanovke problemy.pdf516K 
[   ]Nesipbai Raushan. Geopoliticheskie protivorechiya islamskogo mira i rost radikalnyh islamistskih organizacii.pdf551K 
[   ]nesipbai Raushan.pdf6.6M 
[   ]Nesterenko.pdf7.4M 
[   ]Net-Spaces.pdf445K 
[   ]Neumann.pdf3.5M 
[   ]Nevanlinna.pdf6.8M 
[   ]Neve.pdf3.7M 
[   ]new number of bank card.pdf124K 
[   ]New trends.pdf9.7M 
[   ]new-methods.pdf452K 
[   ]Nikolaevskii.pdf1.0M 
[   ]Nikolskij.Himija.pdf5.8M 
[   ]Nikolĺskiiĺs Inequality for Different Metrics.pdf1.6M 
[   ]Nikulin_geom.pdf5.2M 
[   ]Nikulin_planem.pdf 11M 
[   ]niobii-olovo.pdf9.6M 
[   ]Nisandi b│ld│ret│n funkcionaldi - semantikali? b│rl│kter.pdf2.2M 
[   ]Niyazbaeva A.T.Osnovnye problemy v razvitii turistskogo rynka Respubliki Kazahstan i puti ih resheniya.pdf1.0M 
[   ]Niyazbayeva.pdf130K 
[   ]NMA0600.pdf200K 
[   ]NNC_RK_Bulletin_1_25_2006 (1).pdf5.1M 
[   ]NNC_RK_Bulletin_1_25_2006.docx4.7M 
[   ]NNC_RK_Bulletin_1_25_2006.pdf5.1M 
[   ]NNC_RK_Bulletin_1_29_2007.docx3.4M 
[   ]NNC_RK_Bulletin_1_29_2007.pdf5.6M 
[   ]NNC_RK_Bulletin_4_16_2003.docx5.0M 
[   ]NNC_RK_Bulletin_4_16_2003.pdf3.5M 
[   ]NNC_RK_Bulletin_4_8_2001.docx1.6M 
[   ]NNC_RK_Bulletin_4_8_2001.pdf4.7M 
[   ]NNC_RK_Zharshisi_4_40_2009.pdf6.8M 
[   ]Noks.pdf3.5M 
[   ]Nomidzu.pdf1.1M 
[   ]Norden_geom.pdf 17M 
[   ]Norden_poverh.pdf4.5M 
[   ]Norm-inequalities.pdf140K 
[   ]norma-vremeni.pdf185K 
[   ]Novie vershini masterstva kazahstankoy kinematograficheskoy źNovoy volni 90-h╗ źShuga╗ Darezhana Omirbaeva.doc 50K 
[   ]Novikov.Osnovy.pdf6.1M 
[   ]novoe.pdf655K 
[   ]Novogilov.pdf7.1M 
[   ]Novokshenov.pdf458K 
[   ]NOVYE-REZUL'TATY-I-PERSPEKTYVY.pdf306K 
[   ]novyi.pdf230K 
[   ]NPA734E53-04.pdf206K 
[   ]nrom-convalution.pdf223K 
[   ]Nuclear Instruments and Methods in Physics B.pdf592K 
[   ]Nuclear Instruments and Methods in Physics Research B. Color center creation in LiF crystals irradiated with Xe, Kr and N ions Dependence on fluence and beam current density.pdf592K 
[   ]Nukenov A. Vlast i grajdanskoe obshestvo v Kazahstane liniya zrelosti i otvetstvennosti.pdf660K 
[   ]Nukenov Abzal.pdf575K 
[   ]Nukenov.pdf6.5M 
[   ]NUPHA_18959.pdf1.0M 
[   ]Nur AstanaA41.pdf2.4M 
[   ]nuradinov a.s. psihologicheskie aspekty opisaniya truda administrativno-upravlencheskogo personala.pdf629K 
[   ]Nurkenov-Kislitsin-Rusakov-Kadyrzhanov.pdf1.1M 
[   ]Nurmanbetova.pdf171K 
[   ]Nurseitova-Angliskii yazik.pdf925K 
[   ]Nurseyitova - Agilshin tili.pdf822K 
[   ]nursultanov (1).pdf142K 
[   ]nursultanov.PDF247K 
[   ]nursultanov09.pdf 22K 
[   ]nursultanov1.PDF296K 
[   ]nursultanov13.PDF503K 
[   ]nursultanov15.PDF571K 
[   ]nursultanov19.PDF300K 
[   ]nursultanov20.PDF339K 
[   ]nursultanov23.PDF553K 
[   ]nursultanov25.PDF3.7M 
[   ]nursultanov28.PDF581K 
[   ]Nurtazina Politicheskie.pdf687K 
[   ]nusultanov.pdf 26K 
[   ]O NEKOTORIH ASPEKTAH FORMIROVANIYa KAZAHSKOGO NASELENIYa I POLOZHENIYa ISLAMA NA TERRITORII ZAPADNOY SIBIRI.doc 88K 
[   ]O nekotorih voprosah, svyazannih s raspoznavaniem kazahskoy rechi.pdf6.4M 
[   ]O novim metode KazGU.pdf8.4M 
[   ]O problemah sozdaniya global'noy valyuti.doc142K 
[   ]O-GOSUDARSTVE-I-KUL'TURE.pdf240K 
[   ]O-KAZAHSKOM-VLIANII-NA-ROSSIISKIH-KAZAKOV.pdf149K 
[   ]o-klassicheskoi-formule.pdf2.7M 
[   ]o-koefficientax.pdf1.7M 
[   ]o-logike-algebri4eskogo-sostavliauwei-matemati4eskogo-obrazovanie-II.pdf401K 
[   ]o-logike-algebri4eskoi-sostavliauwei-matemati4eskgo-obrazovanie-I.pdf402K 
[   ]o-nijnei-ocenke.pdf300K 
[   ]O-plotnih-mnojestvah-i-nekotoroh-ocenkah-norm-operatora-vlojenie-v-banohovoh-prostranstvah.pdf1.1M 
[   ]o-ponyatii.pdf165K 
[   ]O-PRIMENENII-I-RAZVITII-NASLEDIA.pdf210K 
[   ]o-prirode-spektra.pdf5.4M 
[   ]O-PRISHOZHDENII-TOPONIMA-ZHETYSU.pdf188K 
[   ]O-PROISHOZHDENII-KAZAHOV.pdf154K 
[   ]o-spektre-differencialnyh-operatorov.pdf8.1M 
[   ]O-spektre-odnogo-klassa-differencialnih-operatorov-i-nekotorie-teorema-vlojenie.pdf1.7M 
[   ]o-sumiruemosti.pdf741K 
[   ]O-teoremah-vlojenie-i-spektre-odnago-psevdodifferencialnogo-operatora.pdf2.6M 
[   ]o-tipe-rezolventy.pdf2.8M 
[   ]O.BOKEI.pdf147K 
[   ]Ob-bobwennoi-sisteme-Kowi-Rimanna-s-negladkami-koefcentami.pdf701K 
[   ]OB-ETNOGENZE-HUNNOV.pdf160K 
[   ]ob-integralnyx.pdf568K 
[   ]ob-interpolyacii.pdf293K 
[   ]ob-obobwennoi.pdf235K 
[   ]ob-odnom-kriterii-yadernosti.pdf2.4M 
[   ]Ob-odnom-metode-fiktivnoi-oblasti-dlia-neleneinih-kraevih-zadach.pdf273K 
[   ]Ob-odnom-metode-priblejennih-rewenii-neleneinih-uravnenii-v-proizvodnii-oblasti.pdf220K 
[   ]Ob-odnom-priblejennim-metode-rewenie-kraevih-zadach-so-slojnimi-granichnimi-usloviami.pdf240K 
[   ]ob-odnom.pdf749K 
[   ]OB-OSOBENNASTIAH-ORGANIZACII.pdf258K 
[   ]ob-usloviah-samosopryazhennosti.pdf7.7M 
[   ]Ob-usloviah-somasoprajennosti-operatorov-wreddingera-i-diraka.pdf2.2M 
[   ]oblojenii.pdf400K 
[   ]oblozhka 1.docx450K 
[   ]Obnovlenie soderzhaniya obrazovaniya doshkol'nih organizaciy cherez novie tehnologii..doc 58K 
[   ]obodnoi-additivnoi.pdf310K 
[   ]obosnovaniye-i-razrabotka-bezothodnoy-technology.pdf195K 
[   ]OBRAZ-EVRAZISKOGO-PROMETEIA.pdf159K 
[   ]Obrazcov.pdf4.4M 
[   ]obzornoi-analiz-strukturi-lekgih-neitronoizbitichnih-iader-6He-i-8He.pdf574K 
[   ]Ocenka effektivnosti deyat Alpisbaeva.docx 30K 
[   ]Ocenka-naimenwego-sobstvennogo-znachenia-odnogo-klassa-matric-sootvetstvuiwego-raznostnomu-uravneniu-wturma-luivilla.PDF438K 
[   ]ocenka-stepeni.pdf659K 
[   ]ocenka-vozdeistvie-okrujaiushiu sredi-(OBOC)-otkritogo-hranenie-seri-na-Tengize.pdf4.3M 
[   ]ocenki konc.radionuk v ob'.s pomo.SAPFIR.pdf192K 
[   ]Ocenki spektra(Otelbaev) 2.pdf8.6M 
[   ]Ocenki spektra(Otelbaev) 3.pdf9.2M 
[   ]Ocenki spektra1(Otelbaev).pdf7.8M 
[   ]Ocenki-approksimativnih chisel-operatora-vlojenie-dlia-prostranstv-sobelovoskogo-tipa-s-vesami.pdf1.9M 
[   ]Ochan.pdf 36M 
[   ]Ocherki Alihana Bukeyhanova na stranicah russkoy pressi.docx 37K 
[   ]Oden.pdf5.4M 
[   ]Odna teorema o prostranstvah.pdf611K 
[   ]odna-obratnaya.pdf224K 
[   ]ofilosofsko.pdf295K 
[   ]okkazionalnye.pdf209K 
[   ]oku-adisteme.pdf1.4M 
[   ]oku.pdf194K 
[   ]Okun.pdf2.8M 
[   ]Okun_lepton.pdf5.5M 
[   ]OKUSHYLARDYN-ADEBY-TILI.pdf149K 
[   ]OKUSHYLARDYN-TIL-MADENIETI.pdf137K 
[   ]Olah.A life of magic chemistry.pdf2.8M 
[   ]Olehnik.pdf1.6M 
[   ]Oleinik.pdf3.8M 
[   ]OLIMGE-BAILANYSTY.pdf161K 
[   ]OLYMP.pdf5.9M 
[   ]Omargazin.pdf1.0M 
[   ]Omarova.pdf2.2M 
[   ]Omasheva.pdf 81K 
[   ]On the sharpness of a certain spectral.pdf319K 
[   ]On the sharpness of a certain.pdf319K 
[   ]On-Inequalities-for.pdf550K 
[   ]On-Interpolation.pdf572K 
[   ]On_variational.pdf371K 
[   ]One-dimensional.pdf406K 
[   ]onin-urani.pdf124K 
[   ]ONLINE.pdf226K 
[   ]Onuchko Inf.pdf947K 
[   ]onuchko m.y.u.normativnaya baza gosudarstvenno-konfessionalnih otnjshenii universalnie i regionalnie istochniki.pdf707K 
[   ]Oosbennosti upravleniya Alpisbaeva.docx 29K 
[   ]operacionnaya.pdf180K 
[   ]Operativno.pdf845K 
[   ]operatorlarynyn.pdf895K 
[   ]Opredelenie naibolee podhodyashey nesmeshennoy ocenki veroyatnosti opravdivaemosti prognoza v meteorologii.pdf209K 
[   ]opredelenie-ostanovochno-antibiotikof.pdf198K 
[   ]opredelenie-parametrov.pdf242K 
[   ]opredelenie-stepeni-porazheniya.pdf326K 
[   ]opredelenie.pdf196K 
[   ]oprimenenii.pdf184K 
[   ]Opritov.Bioelektrogenez.pdf2.7M 
[   ]Optics and spectrosS175.pdf199K 
[   ]Optika i spektros.pdf172K 
[   ]opyt-izucheniya.pdf209K 
[   ]ORALHAN-BOKEI.pdf176K 
[   ]orazalinnin-kuttyktayu.pdf229K 
[   ]Orazymbetova.pdf116K 
[   ]Ore.pdf3.6M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log.jpg784K 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log1.jpg1.6M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log2.jpg1.6M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log3.jpg1.8M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log4.jpg1.6M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log5.jpg1.6M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log6.jpg1.9M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.log7.jpg1.9M 
[   ]Organiz.pas.perev.uslov.rinka prim.prin.logPdF.pdf1.5M 
[   ]ORGANIZACIYa RABOTI MUL'TIMODAL'NIH TRANSPORTNO-LOGISTICHESKIH CENTROV.pdf222K 
[   ]orlov.pdf1.0M 
[   ]ORTAAZIALYK-TEFSIR.pdf167K 
[   ]ortagasyrlyk-adebi.pdf253K 
[   ]ORTAK-TURKI-ADEBIETI.pdf307K 
[   ]Ortega.pdf7.3M 
[   ]Osadko.Fluktuiruyshaya.pdf556K 
[   ]osimdikter.pdf214K 
[   ]OSMYSLENIE-IAZYKOVYH-FAKTOV.pdf188K 
[   ]OSMYSLENII-FENOMENA.pdf280K 
[   ]Osnovy obshei.pdf6.9M 
[   ]Osobennosti energomedia na ostire global'nih energeticheskih vizovov.doc 43K 
[   ]Osobennosti vremennoy perspektivi 1.tif2.8M 
[   ]Osobennosti vremennoy perspektivi.3.tif2.7M 
[   ]osobennosti-kinetiki.pdf1.0M 
[   ]osobennosti-perevoda.pdf277K 
[   ]osobennosti-plastisheskoi.pdf1.0M 
[   ]osobennosti.pdf449K 
[   ]osobennosty-cistanche-deseticola.pdf175K 
[   ]Ospanov (1).pdf1.5M 
[   ]ospanov.PDF630K 
[   ]ospanov11.PDF147K 
[   ]ospanov4.PDF458K 
[   ]Otel.pdf327K 
[   ]Otelbaev. Tuleuov. Zhusopova.pdf208K 
[   ]otelbayev.pdf203K 
[   ]otelbayev12.pdf273K 
[   ]otelbayev5.PDF438K 
[   ]Otnes.pdf 11M 
[   ]otrajenie.pdf233K 
[   ]otyrar-kitaphanasi.pdf203K 
[   ]otyrar-kuttyktayu.pdf202K 
[   ]Ouen.pdf2.4M 
[   ]p.198-209.pdf759K 
[   ]p509.pdf183K 
[   ]p6-2001-223.pdf1.7M 
[   ]pages1.doc 30K 
[   ]Paierls.pdf2.7M 
[   ]Paierls_syurpr.pdf3.0M 
[   ]Palamodov.pdf 17M 
[   ]Palis.pdf4.5M 
[   ]Panagiotopulos.pdf5.0M 
[   ]paper3 Tashatov.pdf297K 
[   ]Paper_010.pdf692K 
[   ]Pars.pdf 11M 
[   ]Parton.pdf3.4M 
[   ]patent 2011.pdf1.7M 
[   ]PATENT KAK TEHNOLOGICHESKAYa MONOPOLIYa.doc 75K 
[   ]Pauli_otn.pdf7.3M 
[   ]Pauli_voln.pdf3.9M 
[   ]Pavlov.pdf 11M 
[   ]Pavlovich.Biomagnitnye.pdf1.5M 
[   ]PDF Gorenie visokoskorostnogo potoka goyuch.gaz.smesey.pdf2.3M 
[   ]Peculiarities.pdf572K 
[   ]PECULIARITY.pdf272K 
[   ]Pekelis.Tvoyi.pdf3.3M 
[   ]Peleh.pdf2.2M 
[   ]Penrouz.pdf9.6M 
[   ]Perelomov.pdf4.2M 
[   ]Perelomov_Li.pdf3.1M 
[   ]Perina.pdf4.9M 
[   ]PERSPECTIVE.pdf183K 
[   ]PERSPEKTIVY-RAZVITIA-KAZAHSKOGO-IAZYKA.pdf183K 
[   ]Pervie 2 str.sbornika.doc 33K 
[   ]Peskin.pdf4.4M 
[   ]pesnya-Vladimira.pdf258K 
[   ]Petrina.pdf2.8M 
[   ]Phenomenological_Gaussian.pdf 80K 
[   ]Photonic_Drag_Effect.pdf135K 
[   ]Physica B. Ab inito calculations of MgF2 (001) and (011) surface structure.pdf152K 
[   ]Physica status solidi B. Electron color center creation in LiF irradiated with Kr ions.pdf905K 
[   ]Physica status solidi. Electron color center creation in LiF irradiated with Kr ions.pdf905K 
[   ]physics_space_2008.pdf3.4M 
[   ]Picetti.pdf2.1M 
[   ]Pinigin.pdf3.8M 
[   ]Pinni.pdf3.0M 
[   ]Pinskii.pdf6.0M 
[   ]Planirov.razv.intermodal'nih sistem v mezh.soobshPdF.pdf2.6M 
[   ]PNAS-2003-Shestakov-12561-3.pdf171K 
[   ]Pobedrya.pdf2.6M 
[   ]Podgotovka.pdf5.4M 
[   ]podlekciya.pdf319K 
[   ]Podyapolskii.pdf589K 
[   ]Poia.pdf9.1M 
[   ]pojiznennoe-liwenie.pdf265K 
[   ]Pol'sha.jpg198K 
[   ]Pol'sha1.jpg127K 
[   ]Pol'sha2.jpg322K 
[   ]Pol'sha3.jpg448K 
[   ]Pol'sha4.jpg409K 
[   ]Polak.pdf9.8M 
[   ]polevie-ispitanie-gruntov-svaiami-na-plowadke-stroitelstva-sportivnogo-kompleksa-v-gorde-Astana.pdf1.2M 
[   ]polimorfizm-gena-interleikina-1.pdf204K 
[   ]polimorfniye-varianty-genov.pdf299K 
[   ]politisheskaya.pdf152K 
[   ]poluchenie-i-harakteristika-mezemhimalnyh-stvolovyh.pdf169K 
[   ]poluchenie-poliklonalniyh-antitel.pdf261K 
[   ]polucheniye-i-harakterisitka.pdf194K 
[   ]polucheniye-recombinantnogo-belka.pdf278K 
[   ]Polyakov.pdf1.3M 
[   ]Polyhedron-v31-2012.pdf484K 
[   ]Pontryagin.pdf7.2M 
[   ]Pontryagin1.pdf5.8M 
[   ]Popov.Asfericheskie.pdf2.9M 
[   ]Popov.Koncentricheskie.pdf1.7M 
[   ]Popov.pdf9.8M 
[   ]Popov.Sovremennaja.pdf2.5M 
[   ]Popov_integr.pdf3.3M 
[   ]Popov_teor.pdf8.0M 
[   ]Posledn list.jpg177K 
[   ]Poslednyaya stranica sbornika.doc 24K 
[   ]poslednyaya stranica Vestnika.doc 42K 
[   ]Postnikov.pdf2.8M 
[   ]Postroenie logicheskoy semantiki slov kazahskogo yazika.pdf2.6M 
[   ]postroenie-sistem-upravlenie-s-povishennom-potencialom-robastnoi-ustoichivosti.pdf615K 
[   ]POSTSOVETSKI-NAUCHNY-DISKURS.pdf374K 
[   ]Povishenie effektivnosti teploobmena v processe sushki fosfolipidnih.pdf208K 
[   ]povyshenii.pdf544K 
[   ]POVYWENIE-STATUSA.pdf244K 
[   ]Poya.pdf1.7M 
[   ]Pr1080.pdf191K 
[   ]Pr877.pdf223K 
[   ]Pr993.pdf265K 
[   ]Praktikum.pdf8.0M 
[   ]Prandtl.pdf4.0M 
[   ]Prasolov_algebra.pdf5.5M 
[   ]Prasolov_Brokar.pdf222K 
[   ]Prasolov_Lobachevskii.pdf670K 
[   ]Prasolov_planim.pdf5.4M 
[   ]Prasolov_stereo.pdf 41M 
[   ]Prasolov_topol.pdf1.3M 
[   ]Pratton.pdf1.7M 
[   ]predstavlenie-basni.pdf167K 
[   ]Prekrawenie-gorenie-tverdih-raketnih-topliv-i-vzrivchatih-mucuiem-pri-peremennom-davlenii.pdf173K 
[   ]Preobrazhenskiy.Volny.pdf236K 
[   ]Prestupnie yavleniya v predprinimatel'skoy sfere.pdf2.1M 
[   ]Prett1.pdf4.1M 
[   ]Prett2.pdf8.0M 
[   ]Prezident i istoriya suvereniteta.docx 16K 
[   ]Price.Animal.pdf 24M 
[   ]Prigojin_opred.pdf936K 
[   ]Prigojin_ter.pdf676K 
[   ]Prigojin_therm.pdf6.6M 
[   ]Prim.met.FAN.pdf7.4M 
[   ]PRIMENENIE-PREDELOV-METODOV-ESTESTVENNYH-NAUUK.pdf254K 
[   ]primenenie.pdf858K 
[   ]PRIMEN~1.DOC 69K 
[   ]princip.pdf836K 
[   ]PRINCIPI SOZDANIYa MUL'TIMODAL'NIH TRANSPORTNO-LOGISTICHESKIH CENTROV.doc 61K 
[   ]principialnaia-elektricheskaia-shema-i-mehanicheskie-parametri-mnogodvigatelnogo-asinhronnogo-elektroprivoda-so-smeshennom-upravleniem-.pdf5.4M 
[   ]privetstvennoe-slovo.pdf160K 
[   ]Probl VM i IT.pdf2.0M 
[   ]Problema belka.T.2.pdf7.3M 
[   ]PROBLEMA-DUHOVNOSTY-CHELOVEKA.pdf142K 
[   ]PROBLEMA-IZUCHENIE-ETNOSA.pdf149K 
[   ]PROBLEMI I PERSPEKTIVI RAZVITIYa KAZAHSTANSKOGO.doc525K 
[   ]problemi-kompleksnoi-ocenki-geoekosistem-stepnoi-zoni-basseina-r.Urala.pdf2.2M 
[   ]Problems-in-Design-of-the-New-Microwave-Geophysical-Measuring-System.pdf2.6M 
[   ]problemy-formirovaniya.pdf222K 
[   ]problemy-imidja.pdf225K 
[   ]problemy-razvitiya.pdf235K 
[   ]problemy-snijeniya.pdf206K 
[   ]problemy-sozdaniya.pdf207K 
[   ]problemy-vnedreniya.pdf262K 
[   ]problemy.pdf185K 
[   ]professor-jurtpai.pdf191K 
[   ]ProgramSchedule041008.pdf7.6M 
[   ]Prohorov.pdf6.3M 
[   ]prorastaya vechnost'yu.docx 15K 
[   ]PRORYVNAIA-FAZA-TIURKOV.pdf155K 
[   ]protemnye-issledovaniya-belok-belkovyh.pdf198K 
[   ]prozalyk.pdf218K 
[   ]Prudnikov.pdf 18M 
[   ]Puankare.pdf5.5M 
[   ]Puankare1.pdf956K 
[   ]Puankare2.pdf5.2M 
[   ]Puankare_dif.pdf6.0M 
[   ]Puankare_figure.pdf758K 
[   ]Puankare_last.pdf849K 
[   ]Puankare_vihri.pdf612K 
[   ]public-2013-final-version.rtf307M 
[   ]publikacii Akimovoy B.Zh.doc 48K 
[   ]publikacii Eszhanovoy.doc 41K 
[   ]Publikacii.pdf3.2M 
[   ]Puryaev.Metody.pdf3.5M 
[   ]Pushkin.pdf281K 
[   ]Pussen1.pdf6.0M 
[   ]Pussen2.pdf4.2M 
[   ]Putilov.pdf4.7M 
[   ]pztf_t27v24_15.docx510K 
[   ]pztf_t27v24_15.pdf 78K 
[   ]pztf_t29v03_01.docx482K 
[   ]pztf_t29v03_01.pdf 99K 
[   ]q-Deformed.pdf207K 
[   ]Qandilov.pdf120K 
[   ]qua.22724.pdf276K 
[   ]Quantum-Dimensional-Zeeman.pdf 99K 
[   ]Quasicanonical-Gibbs.pdf201K 
[   ]R.K. Niyazbekova, L.A. Baybosinova.docx 38K 
[   ]R.Turisbek Adebi sinnin tabigati men tagilimi.pdf918K 
[   ]R.Turisbek ult ruhaniatinin biik belesi.pdf4.3M 
[   ]Rabinovich.Kratkij.pdf4.7M 
[   ]Rabotnov.pdf4.5M 
[   ]Rachev.pdf3.0M 
[   ]Rad.def.v krist. Kaynarbay.pdf427K 
[   ]Rahimjan Turisbek Batyrdin biik tulgasi.pdf793K 
[   ]Rahmetov.pdf 11M 
[   ]Rakitin.pdf5.4M 
[   ]Ramazan-08.pdf4.7M 
[   ]Ramm.pdf4.8M 
[   ]raspredelie-sobstvennyh.pdf623K 
[   ]Rauk.Orbital.pdf3.6M 
[   ]razlishie.pdf2.6M 
[   ]RAZNIM TIPOM yaKoncEPcII.tif2.8M 
[   ]RAZRABOTKA I REALIZACIYa ELEKTRONNIH DIDAKTICHESKIH.pdf165K 
[   ]razrabotka-kariernih-plastinchatih-konveierov-dlia-transportirovki-vskrishnih-porod.pdf384K 
[   ]razrabotka-tehnologii-sozdanie-i-optimalnoe-planirovanie-i-raspredelenie-resurosov-integrirovanni-sistemoi-upravlenie-infarmacionnim-obrazovatilnom-portalom.pdf807K 
[   ]razrabotka.pdf155K 
[   ]Razvitie log.centrovPdf.pdf1.5M 
[   ]razvitie-ushetnoi.pdf278K 
[   ]realiya.pdf260K 
[   ]RECONSTRUKCIA-VNESHNEGO-OBLIKA.pdf165K 
[   ]redakcialik-jane-plazmalik-1.pdf4.2M 
[   ]REDIOZHURNALISTTIN-SOILEU-SHEBERLIGI.pdf138K 
[   ]REGULATION OF MONOPOLIES IN ECONOMY EXPERIENCE OF THE.doc 83K 
[   ]reguliacia-fiziologicheskih-funkcii-TOR-signalnoi-sistemoi-v-Arabidopsisthaliana.pdf1.1M 
[   ]Reislend.pdf4.8M 
[   ]Reissig.pdf3.8M 
[   ]Reist.Aerosol.pdf5.5M 
[   ]Rejimi-gorenie-tverdogo-raketnogo-topliva-raspadiushego-na-gaz-po-mehanizmu-proliza.pdf406K 
[   ]REKONSTRUKCIA-BERDIKOZHA-BATYRA.pdf2.0M 
[   ]rep3551.pdf156K 
[   ]reprezentaciya.pdf226K 
[   ]Research of Electronic Absorption Spectra of Benzazols Derivatives by Ab Initio Calculations.pdf333K 
[   ]Research-of-essential-oils-from-plants-of-Asteraceae-family-Somposition-of-essential-oil-from-Stizolophus-balsamita (Lam.) Cass..pdf1.0M 
[   ]reshenie-problem-vodootvedenie-goroda-Astana.pdf371K 
[   ]reshenie.pdf324K 
[   ]Reshetnikov.pdf2.7M 
[   ]retrospektivnaia-ocenka-radiacionnoho-zarajenia-na-organizm-jivotnih-chast1.pdf410K 
[   ]retrospektivnaia-ocenka-radiacionnoho-zarajenia-na-organizm-jivotnih-chast2.pdf438K 
[   ]Rezervi energosberezheniya v processe sushki fosfolipidnoy emul'sii.pdf222K 
[   ]Ribchin.pdf 77M 
[   ]Ridley.Cell.pdf8.6M 
[   ]rimgali nurgali.pdf 12M 
[   ]Rimkevich.pdf3.4M 
[   ]RINOK ZERNA KAZAHSTANA.pdf450K 
[   ]Risbekova.pdf 11M 
[   ]RISUNKI-NA-KOSTIAH.pdf217K 
[   ]rm1156.pdf205K 
[   ]rm49.pdf201K 
[   ]rm7670.pdf240K 
[   ]Robinson.Qenetics.Vol.2.pdf 38M 
[   ]Robinson.Qenetics.Vol.3.pdf 40M 
[   ]Rodionov.pdf1.0M 
[   ]Rogers.Computational.pdf1.8M 
[   ]Rohlin.pdf9.8M 
[   ]rol'.pdf202K 
[   ]rol-akreditacii-v-obespechenii.pdf207K 
[   ]rol-GPS.pdf446K 
[   ]rol-nanometrologii-pri-vnedrenii.pdf3.4M 
[   ]rol-nanometrologii.pdf4.7M 
[   ]rol-tyurkskoi.pdf217K 
[   ]role-GMP1.pdf4.7M 
[   ]role-GMP2.pdf3.4M 
[   ]Role-of-Various.pdf730K 
[   ]Romanovskij.Matematicheskaja.pdf3.4M 
[   ]Rotenberg.Mozg.pdf2.9M 
[   ]Rothammel.pdf 20M 
[   ]Rouz.pdf1.6M 
[   ]Rozin.pdf1.9M 
[   ]Ruban.docx 16K 
[   ]Rubin-Shinkarev.Transport.pdf 41M 
[   ]Ruchanze.pdf 17M 
[   ]Rudenko.Gigantskie.pdf554K 
[   ]Rudenko.pdf3.2M 
[   ]Ruel.pdf901K 
[   ]Ruhani silkinis.pdf3.5M 
[   ]Rumer_opt.pdf1.4M 
[   ]Rumer_spin.pdf954K 
[   ]Rumyancev.pdf4.0M 
[   ]Rurk.pdf2.9M 
[   ]Rusakov.pdf819K 
[   ]Rusakov_elektro.pdf1.0M 
[   ]Rusakov_meh.pdf2.6M 
[   ]Rusakov_mol.pdf1.7M 
[   ]Russian Physics Journal. Quantum-Chemical Modeling of Radiation Defects Stabilization and Association in Alkali Haloid Crystalss.pdf830K 
[   ]Russion.pdf1.2M 
[   ]RUSSKIE-EVROZYCY.pdf295K 
[   ]Russko-ukrainsko-latinskij slovar.pdf2.8M 
[   ]Russo.pdf4.0M 
[   ]Rybin.docx 15K 
[   ]S++BuilderZert27.doc7.1M 
[   ]s-begalin-murasin.pdf191K 
[   ]S-benzolirovanie-arilidenproizvodnih-tiobarbitorivii-kisloti.pdf1.9M 
[   ]S.A.Tuleubaeva Ob izuchenii pamyatnikov pismennosti vostoka v Kazahstane (lingvoistochnikovedcheskii aspekt).pdf1.1M 
[   ]S.Negimov malik gabdullin jane el adebieti.pdf2.5M 
[   ]S.Tuleubaeva lingvofilosofskoe nasledie al-Farabi.pdf3.6M 
[   ]S0002-9939-01-06203-7.pdf177K 
[   ]S0894-0347-03-00438-7.pdf236K 
[   ]S0894-0347-03-00440-5 (1).pdf418K 
[   ]S0894-0347-03-00440-5.pdf418K 
[   ]sabdenov6.PDF1.2M 
[   ]sabir.pdf567K 
[   ]Sadovnichii2.pdf1.2M 
[   ]saginov k.m. mentalnost kak sociokuiturnoi fenomen teoriya i istoriya voprosa.pdf536K 
[   ]Sagintaeva A.K. K nekotorym voprosam politicheskoi korrektnosti v angloyazichnoi presse.pdf864K 
[   ]sailau.pdf296K 
[   ]Sailaubekkizi.pdf1.1M 
[   ]Saimon.pdf4.4M 
[   ]Saimova.pdf 11M 
[   ]Salem.Electrons.pdf 41M 
[   ]Salihov.pdf1.8M 
[   ]Salihov.Spinovay.pdf1.8M 
[   ]Salistiru konstrukciyalarini? semantikali? ??rilimi.doc 59K 
[   ]SAM5217.pdf 43K 
[   ]Samarskii.pdf5.3M 
[   ]Samohodnie gornie mashini.jpg761K 
[   ]Samohodnie gornie mashini1.jpg682K 
[   ]Samohodnie gornie mashini2.jpg752K 
[   ]Samohodnie gornie mashini3.jpg242K 
[   ]Samohodnie gornie mashiniPdF.pdf557K 
[   ]Samoilenko.pdf 12M 
[   ]samuratova T.pdf574K 
[   ]samuratova.pdf1.4M 
[   ]San-Gam.pdf4.1M 
[   ]Sanches-Palensiya.pdf5.1M 
[   ]Sanchez.Biomedical.pdf5.4M 
[   ]Sapa ľ nari?ti? ekonomika zha?dayinda tabisti ?izmett│? neg│zg│ faktorlarini? b│r│ ret│nde.doc 66K 
[   ]saparbayevtin-kyttyktayu.pdf213K 
[   ]Saranin.pdf780K 
[   ]Sardanashvili3.pdf3.7M 
[   ]Sarnak.pdf2.7M 
[   ]sarsekeev.pdf2.1M 
[   ]sartkojauli karjaubai.pdf1.2M 
[   ]satinnova.pdf488K 
[   ]satinova.pdf614K 
[   ]Sato.pdf1.9M 
[   ]Satybaldina.pdf572K 
[   ]sauattylyk-igertu.pdf281K 
[   ]Sautova.pdf130K 
[   ]Savchenko.pdf951K 
[   ]Savchenko1.pdf4.0M 
[   ]Saveleva - Sharipova.pdf1.0M 
[   ]Savickii.pdf1.5M 
[   ]savitskiy_evraziystvo.pdf1.0M 
[   ]Savostyanov.pdf3.8M 
[   ]sayakhimova.pdf126K 
[   ]Sbornik A. Seydimbek.doc5.9M 
[   ]Sbornik materialov mezhdunarodnoy nauchno-prakticheskoy konferencii.pdf1.5M 
[   ]SBORNIK SONINA AVTORLAR.docx 13K 
[   ]Sbornik trudov.pdf6.7M 
[   ]Sbornik v tipografiyu.doc 61M 
[   ]Sbornik zadach.pdf1.1M 
[   ]sbornik-psihology-healthy-part1-2013.doc5.6M 
[   ]sbornik-psihology-healthy-part2-2013.doc3.9M 
[   ]Scan-1.pdf709K 
[   ]Scan-10.pdf753K 
[   ]Scan-11.pdf809K 
[   ]Scan-12.pdf650K 
[   ]Scan-13.pdf1.1M 
[   ]Scan-14.pdf700K 
[   ]Scan-15.pdf927K 
[   ]Scan-16.pdf589K 
[   ]Scan-17.pdf799K 
[   ]Scan-18.pdf1.0M 
[   ]Scan-2.pdf596K 
[   ]Scan-3.pdf1.0M 
[   ]Scan-4.pdf1.0M 
[   ]Scan-5.pdf666K 
[   ]Scan-6.pdf586K 
[   ]Scan-7.pdf529K 
[   ]Scan-8.pdf413K 
[   ]Scan-9.pdf470K 
[   ]Scan0001.jpg567K 
[   ]Scan0001.tif1.1M 
[   ]Scan0002.jpg464K 
[   ]Scan0002.tif1.6M 
[   ]Scan0003.jpg438K 
[   ]Scan0003.tif2.2M 
[   ]Scan0004.jpg542K 
[   ]Scan0004.tif4.0M 
[   ]Scan0005.jpg452K 
[   ]Scan0005.tif1.9M 
[   ]Scan0006.jpg444K 
[   ]Scan0006.tif1.3M 
[   ]Scan0007.jpg559K 
[   ]Scan0007.tif1.2M 
[   ]Scan0008.jpg567K 
[   ]Scan0008.tif1.5M 
[   ]Scan0009.tif1.4M 
[   ]Scan0010.tif1.3M 
[   ]Scan0011.tif1.7M 
[   ]Scan0012.tif1.5M 
[   ]Scanavi.pdf 11M 
[   ]Schaums.pdf8.0M 
[   ]Scott.Biology.pdf3.2M 
[   ]Securitization of Chinese Migration in Kazakhstan.pdf273K 
[   ]Seidahmetova F.S..pdf299K 
[   ]Seimov.pdf3.8M 
[   ]Seipisheva.pdf 11M 
[   ]Seitkazy.pdf764K 
[   ]seitkulov.PDF619K 
[   ]SEITOV ASILBEK ľ DOSTOYNIY SIN I PATRIOT ZEMLI OMSKIH KAZAHOV.doc 55K 
[   ]SEKCIYa 1. Matematika.docx3.2M 
[   ]sekciya 1.doc2.7M 
[   ]sekciya 2. docx.docx2.2M 
[   ]SEKCIYa 2. MPM.docx573K 
[   ]SEKCIYa 3. Mehanika .docx4.5M 
[   ]sekciya 3.docx526K 
[   ]Sekei.pdf4.6M 
[   ]SEL'SKO.docx 35K 
[   ]selection.pdf1.2M 
[   ]Sembieva L.docx 22K 
[   ]Semenov.Himija.pdf4.1M 
[   ]semey-yadrolyk-poligony.pdf197K 
[   ]SEMIOTICHESKAIA-INTERPRETACIA.pdf167K 
[   ]Sena.pdf398K 
[   ]Sergeev.pdf 16M 
[   ]SERIK-AKSUNKARULY.pdf166K 
[   ]Seriya matem. Izv. AN SSSR.pdf 19M 
[   ]Serr.pdf5.0M 
[   ]Serrin.pdf3.1M 
[   ]Seysinbinova Moskva tezisi.pdf608K 
[   ]sh. hamada.pdf419K 
[   ]shadi-zhangirulinin.pdf210K 
[   ]shagabutdin-marzhani.pdf488K 
[   ]shagarmashilik-alemnin.pdf254K 
[   ]Shahanova Fizika.pdf883K 
[   ]Shaimardanova Z.D. Nacionalno-osvoboditelnie dvijeniya kazahov v traktovke francuzskoi istoriografii.pdf1.2M 
[   ]Shakishev.pdf 11M 
[   ]shalkhyma.pdf180K 
[   ]SHALKYMA-SHALKAR.pdf147K 
[   ]Shamahai.pdf1.1M 
[   ]Shapoval.pdf1.2M 
[   ]Sharipbaev A.A. Rifa V.N. Metod dinami.harakter.v zadach identifikacii polz.po upravl.manipulyatorom.pdf828K 
[   ]Sharipbayeva.pdf127K 
[   ]Sharpak.pdf758K 
[   ]Shaskolskaya.pdf3.1M 
[   ]Shataeva.Peptidnaja.pdf2.8M 
[   ]Shaukenov A T Nekotorye.pdf1.1M 
[   ]shaukenov a.t. materialnye i processualnye normy v nalogovomprave (kriterii razgranicheniya).pdf907K 
[   ]Shaukenov Izmenenie.pdf2.1M 
[   ]shaukenov. kochevoe gosudarstvo kazahov i publichnye finansy v XVII-XVIII vekah.pdf1.8M 
[   ]Shaukenov.pdf 11M 
[   ]shear-punch.pdf584K 
[   ]Sheperd.Nejrobiologija.T.1.pdf7.3M 
[   ]Sheperd.Nejrobiologija.T.2.pdf5.6M 
[   ]Sherief 12c+12c.pdf633K 
[   ]sherief16O+27Al.pdf326K 
[   ]Sherkhan-Murtazanyn.pdf251K 
[   ]Shevchenko.Luna.pdf4.6M 
[   ]Shilov.pdf7.9M 
[   ]Shilov12.pdf5.0M 
[   ]Shilov3.pdf3.8M 
[   ]Shilov_np12.pdf 11M 
[   ]Shkerzhik.pdf1.2M 
[   ]Shklyarskii.pdf5.8M 
[   ]Shmidt-Nielsen.Razmery.pdf3.4M 
[   ]Shmiglevskii.pdf3.5M 
[   ]Shmutcer.pdf7.7M 
[   ]Shmutcer_sim.pdf1.7M 
[   ]Shnol.Fiziko-himicheskie.pdf3.3M 
[   ]SHNYWKYLY-BERDIKOZHA-BATYR.pdf224K 
[   ]Shpindler.pdf6.7M 
[   ]Shredinger_greki.pdf335K 
[   ]Shredinger_life.pdf919K 
[   ]Shredinger_nauka.pdf251K 
[   ]Shredinger_razum.pdf347K 
[   ]Shredinger_stat.pdf477K 
[   ]Shteinman.pdf1.2M 
[   ]Shtejnberg.Reportazh.pdf4.6M 
[   ]Shternfeld.pdf7.1M 
[   ]Shulgin.pdf2.1M 
[   ]Shvarc.pdf1.3M 
[   ]Shvinger.pdf7.5M 
[   ]Shwarc.pdf3.0M 
[   ]Shwartz1.pdf8.6M 
[   ]Shwartz2.pdf6.1M 
[   ]Shweber.pdf 13M 
[   ]shygys-xalyktarynyn.pdf219K 
[   ]SIBIRSKI.M.Zh.T.XXIV.╣4.pdf7.8M 
[   ]SIBIRSKIE-OBLASTNIKI.pdf155K 
[   ]Sidiknazarov M.pdf4.6M 
[   ]Sidikov E.pdf689K 
[   ]sidikova m..pdf481K 
[   ]sidikova marjan.pdf464K 
[   ]Sidorov.pdf7.1M 
[   ]Sikoruk.Lubitel'skaja.pdf4.9M 
[   ]SillabusGlossariyOkonchat.doc128K 
[   ]Simiu.pdf6.2M 
[   ]Simo.pdf2.8M 
[   ]Simonetta.Molekularnue.pdf 20M 
[   ]simvolika-altaiskoi.pdf221K 
[   ]simvolika.pdf340K 
[   ]Sinai.pdf2.4M 
[   ]Sinay.pdf3.1M 
[   ]Sing.pdf5.3M 
[   ]SINIAIA-ORDA.pdf359K 
[   ]Sinkler.pdf1.1M 
[   ]Sintez slovoform tyurkskih yazikov s pomosh'yu semanticheskoy neyronnoy seti.pdf8.1M 
[   ]sist-lin.doc165K 
[   ]SISTEMA UPRAVLENIYa DELOVOY KAR'EROY KAK FAKTOR MOTIVACII.doc 82K 
[   ]sistema-obrazovaniya.pdf159K 
[   ]sistematisheskie-lineinye.pdf330K 
[   ]sistematisheskoe.pdf289K 
[   ]Sistemi dostavki tovarov v mezhdunarodnih soobsheniyahPdf.pdf2.5M 
[   ]Sivashinskii.pdf4.0M 
[   ]Sizd_Ocenka ekonomich. effekt. realiz. programm...doc104K 
[   ]Sizd_Ocenka zatrat i effektivnosti zakupochno-raspredelit....doc 81K 
[   ]Sizd_Osnovnie metodologich. principi formirov. tl klastera.doc 64K 
[   ]Sizd_Perspektivi razvitiya transport.-log. klastera.doc 75K 
[   ]Sizd_Rol' logistiki....doc 85K 
[   ]sizdikova G.pdf1.0M 
[   ]sizikti-minimal-alternativti-sakinalar-men-algebralar.pdf492K 
[   ]sizikti-minimal-associativti-sakinalar.pdf546K 
[   ]sjvm398.pdf691K 
[   ]Skewness.pdf223K 
[   ]Skrins- from SCOPUS-Abitova - kopiya.docx700K 
[   ]Skrins- from SCOPUS-Abitova.docx698K 
[   ]Sleter.pdf9.9M 
[   ]Slobodeckii.pdf5.5M 
[   ]Slusarev_met.pdf7.4M 
[   ]Slusarev_rasch.pdf6.7M 
[   ]sm2311.pdf1.6M 
[   ]sm2712.pdf1.2M 
[   ]sm30.pdf2.0M 
[   ]sm309.pdf333K 
[   ]SMAGUL-ELUBAI.pdf179K 
[   ]Smagulov E.M..pdf2.8M 
[   ]Smagulov.pdf220K 
[   ]Smagulova.pdf142K 
[   ]Smailova.pdf 11M 
[   ]Smil.The Earth.pdf1.1K 
[   ]Smit.pdf9.7M 
[   ]Smith.Solving.pdf2.9M 
[   ]smj147.pdf1.1M 
[   ]smj604.pdf652K 
[   ]smj822.pdf1.1M 
[   ]Smoljaninov.Matematicheskie.pdf5.8M 
[   ]SMZh tom XVII nom. 4.pdf6.3M 
[   ]snijenie-rasxoda.pdf253K 
[   ]Sobolev.pdf6.2M 
[   ]sobremennoe.pdf252K 
[   ]SOCIAL.pdf164K 
[   ]Soderzh.jpg572K 
[   ]Soderzhanie 2013.doc279K 
[   ]Soderzhanie-2.pdf501K 
[   ]soderzhanie.docx 39K 
[   ]soderzhanie_2013.doc240K 
[   ]Sodruzhestvo nezavisimih gosudarstv v 2005-2010 gg. aktual'nie problemi i perspektivi.doc112K 
[   ]Soifer_dig.pdf 25M 
[   ]Soifer_pri.pdf8.2M 
[   ]Soklof.pdf9.4M 
[   ]Sokolovskii.pdf3.3M 
[   ]Solbrig.Populyacionnaja.pdf7.5M 
[   ]somaticheskaya_nominaciya.pdf200K 
[   ]Some cosmological aspects of Ho?rava-Lifshitz gravi.pdf177K 
[   ]Some-cosmological-aspects-of-Ho?rava-Lifshitz-gravity-integrable-and-nonintegrable-models.pdf177K 
[   ]Some-cosmological.pdf177K 
[   ]some-models-of-circle.pdf199K 
[   ]some.pdf270K 
[   ]Sominskii.pdf817K 
[   ]Somjurek B.J. Sovremennyi process formirovaniya evropeiskoi oborony.pdf868K 
[   ]sootn.doc1.5M 
[   ]sopostavlenie.pdf176K 
[   ]sopy-allayardin.pdf207K 
[   ]Sosinskii.pdf1.6M 
[   ]Sotnikov.pdf1.1M 
[   ]sovershenstvovanie instetuta.pdf3.9M 
[   ]sovershenstvovanie.pdf172K 
[   ]sovetskaya-ideologia.pdf247K 
[   ]SOVREMENNAIA-ISTORICHESKAIA-MYSL'.pdf302K 
[   ]Sovremennaja himija.pdf2.8M 
[   ]Sovremennaya.T.1.pdf5.2M 
[   ]Sovremennaya.T.2.pdf5.3M 
[   ]sovremennie-sostoianie-razvitie-sverhkriticheskih-fluidnih-tehnologii.pdf476K 
[   ]sovremennoe-sostoyaenie-razrabotki.pdf203K 
[   ]sovremennye-tendencii.pdf832K 
[   ]sovremennye-teorii.pdf283K 
[   ]SOZ-BEDERLEUDIN-KURALDARY.pdf156K 
[   ]sozderdin.pdf302K 
[   ]sozjasamdyk.pdf310K 
[   ]SOZZHASAMDYK-JURNAKTAR.pdf155K 
[   ]Spiridonov.pdf2.5M 
[   ]SPISOK nauchnih i nauchno-metodicheskih trudov Kalkeevoy Kamariyash Rayhanovni.doc 24K 
[   ]Spisok nauchnih trudov Otelbaeva M..doc539K 
[   ]Spisok.doc 37K 
[   ]spisok.docx 60K 
[   ]Spivak.pdf663K 
[   ]sposob-prigotov.pdf2.0M 
[   ]Spravochnik biohimiika.pdf6.5M 
[   ]sravneniye-infekchioonoy-activnosty.pdf180K 
[   ]Sredinger.pdf658K 
[   ]st1624.pdf225K 
[   ]Staheev.Vsya himija.pdf1.8M 
[   ]stat'i dlya repozitoriya - Alpisbaeva.docx 22K 
[   ]Stat'ya 1 Zhalkenovoy S.T (1).doc 47K 
[   ]Stat'ya 1 Zhalkenovoy S.T (2).doc 57K 
[   ]stat'ya 2 Smagambet Bayan.doc 45K 
[   ]stat'ya 4.docx262K 
[   ]stat'ya 5.docx326K 
[   ]stat'ya Akimovoy BZh 1.docx3.8M 
[   ]stat'ya Akimovoy BZh 2.docx6.6M 
[   ]Stat'ya CentrEvropZhurnal-2011.pdf511K 
[   ]stat'ya Dosanovoy, ENU,Astana.doc 59K 
[   ]Stat'ya ENU Dosanova GM sociologiya.doc 43K 
[   ]Stat'ya Kontrol' kachestva vodi v RK.docx 35K 
[   ]Stat'ya Materials C 1757-899X_15_1_012031.pdf758K 
[   ]Stat'ya Slovakiya gotoviy.pdf484K 
[   ]stat'ya v nauchniy zhurnal Miras.doc 71K 
[   ]stat'ya VAK Dosanovoy sociologiya.doc 68K 
[   ]Stat'ya-1 Smagambet Bayan.doc 68K 
[   ]stat'ya.docx359K 
[   ]stat'ya0159.jpg784K 
[   ]stat'ya0160.jpg1.6M 
[   ]stat'ya0161.jpg1.6M 
[   ]stat'ya0162.jpg1.8M 
[   ]stat'ya0163.jpg1.6M 
[   ]stat'ya0164.jpg1.6M 
[   ]stat'ya0165.jpg1.9M 
[   ]stat'ya0166.jpg1.9M 
[   ]stat'ya1Pdf.pdf1.5M 
[   ]stat'ya2.docx454K 
[   ]Statisticheskie svoistva.pdf583K 
[   ]Steklov.pdf2.5M 
[   ]Stepanov.pdf2.4M 
[   ]Stepanov.Quantum.pdf4.8M 
[   ]STILISTIKADAGY-MODAL-SOZDERDIN-ALATYN-ORNY.pdf138K 
[   ]Stillvell.pdf1.7M 
[   ]Stimulirovanie otkritosti i prozrachnosti deyatel'nosti kak faktor effektivnosti monopolisticheskih sub'ektov ekonomiki.doc378K 
[   ]Stinrod.pdf5.9M 
[   ]Stochastic-models.pdf713K 
[   ]Stochastic.pdf124K 
[   ]Str-1.jpg290K 
[   ]Str-13.pdf1.1M 
[   ]Str-14.pdf761K 
[   ]Str-15.pdf765K 
[   ]Str-16.pdf441K 
[   ]Str-17.pdf759K 
[   ]Str-18.pdf840K 
[   ]Str-19.pdf949K 
[   ]Str-2.jpg1.4M 
[   ]Str-20.pdf380K 
[   ]Str-21.pdf909K 
[   ]Str-22.pdf520K 
[   ]Str-23.pdf1.0M 
[   ]Str-24.pdf896K 
[   ]Str-3.jpg1.3M 
[   ]STRATEGIYa GOSUDARSTVA V OTNOSHENII.doc 53K 
[   ]Stratonovich.pdf5.1M 
[   ]Strelkov.pdf3.9M 
[   ]Strett1.pdf 12M 
[   ]StructureandCombustion.pdf232K 
[   ]Study of Spectral Properties of Bis (1,10-phenanthroline) Silicon Hexacoordinated Complexes by Density Functional Theory.pdf221K 
[   ]STUGENTTIN-ETNOMADENI-KUZIRETTILIGI.pdf316K 
[   ]sub-thereshold.pdf779K 
[   ]subjasaushilik-frakcialaudin-jana-adisi-arkili-mTOR-kompleksterin-zertteu.pdf763K 
[   ]subyrgaktar.pdf267K 
[   ]Sufiyskie motivi i obrazi v sovremennoy mirovoy literature.doc 80K 
[   ]Suieubaeva.pdf111K 
[   ]sultana priziv.docx 31K 
[   ]sultanova.pdf1.4M 
[   ]Sunyaev.pdf 26M 
[   ]suretker.pdf253K 
[   ]suvchinskie.pdf1.4M 
[   ]Svetlana Kojirova Faktor kitaiskoi migraci.pdf801K 
[   ]Svetozarov.pdf2.3M 
[   ]Sviridov A.N. Mejdunarodnaya nauchnaya arheologicheskaya konferenciya Margulanovskie chteniya-2011.pdf907K 
[   ]Switzer.pdf 12M 
[   ]Syarle.pdf4.9M 
[   ]sybailas.pdf187K 
[   ]SYNARLARY-MAGNASYZ-KOS-SOZDER.pdf158K 
[   ]Synthesis-molecular-and-crystal-structure-of-pentacyclic-dimer-of-sabinone.pdf2.4M 
[   ]Synthesis-of-New-Dialkylphosphonates-of-Estafiatine.pdf128K 
[   ]Synthesis-of-New-Dilactone-from-Stizolicin.pdf133K 
[   ]Syrmanova.pdf160K 
[   ]T.ABDIKOV.pdf172K 
[   ]t.k. musalimov graficheskie izobrajeniya kak vajneishee sredstvo poznaniya deistvitelnosti v obuchenii budushego specialista.pdf548K 
[   ]T?TINUSHILI? S?RANISTI? INSTITUCIONALDI? FAKTORLARI.doc 87K 
[   ]tabigaty-taza.pdf227K 
[   ]Tabor.pdf5.4M 
[   ]Tagaeva S.B.stat'ya.doc 86K 
[   ]Taha.pdf 31M 
[   ]Tahan.pdf530K 
[   ]Tahtadgan.pdf9.1M 
[   ]Taimanov.pdf1.4M 
[   ]Tan.Principles.pdf5.4M 
[   ]Tarakanov.pdf8.8M 
[   ]Taraskin_mont.pdf604K 
[   ]Taraskin_skolz.pdf473K 
[   ]tarihi-oi-iesi.pdf170K 
[   ]Tashatov 1.docx 71K 
[   ]Tashatov N.docx 39K 
[   ]tasmaganbetovtin-kyttyktayu.pdf212K 
[   ]taueldik-jalgaular.pdf190K 
[   ]tauelsiz-eldin-tulgasi.pdf218K 
[   ]tauelsizdik.pdf210K 
[   ]tauelsizdiktin-20.pdf276K 
[   ]tayarli-betondi-kurilis-obiektisine-jetkizu-kezindegi-avtobetonaralistirgishti-(ABA)-ekspluatacialaudin-joldik-warttari.pdf412K 
[   ]te_1348_web.docx6.1M 
[   ]te_1348_web.pdf2.6M 
[   ]tech03_2005.pdf2.3M 
[   ]TECHNIQUES.pdf 80K 
[   ]Tedder. Orbital'naja.pdf1.0M 
[   ]tefconferenc.doc 20M 
[   ]tehnologia-postroenie-soprjenno-soglasovannih-raznostnih-shem-dlia-optimizacionnogo-metoda.pdf536K 
[   ]Tehnologiya i meh.proc.transp.i peremesh.materPdF.pdf4.0M 
[   ]Teilor.pdf5.1M 
[   ]Teilor_oshibki.pdf3.0M 
[   ]tekhnika 4,2012.pdf 40M 
[   ]tekst.pdf182K 
[   ]Teleman.pdf5.6M 
[   ]TELEZHURNALISTIKANYN-KYZMETI.pdf147K 
[   ]TELEZHURNALISTTIN-SOILEU-MADENIETI.pdf151K 
[   ]temirgaliyev.pdf123K 
[   ]Temirkulova N.I.-Astana-2011-3.pdf140K 
[   ]Temirkulovoy 1.pdf1.4M 
[   ]Temirkulovoy 3.pdf962K 
[   ]Temirkulovoy 4.pdf1.1M 
[   ]Temirkulovoy 5.pdf1.1M 
[   ]Temirkulovoy.pdf1.4M 
[   ]Temirkulovoy2.pdf1.0M 
[   ]Temirkulovoy7.pdf284K 
[   ]temirovtin-kuttyktayu.pdf214K 
[   ]Teor. vlozh i ih pril..pdf1.9M 
[   ]Teor.i praktika log.cepey postavok gruza.jpg258K 
[   ]Teor.i praktika log.cepey postavok gruza1.jpg230K 
[   ]Teor.i praktika log.cepey postavok gruza2.jpg634K 
[   ]Teor.i praktika log.cepey postavok gruza3.jpg380K 
[   ]Teorema-vlojenie-i-kompaknosti-dlia-prostranstv-sobelevskogo-tipa-s-vesami.pdf1.2M 
[   ]Teorema-vlojenie-kompaknosti-dlia-prostransv-sobelovaskogo-tipa-s-vesami.pdf1.6M 
[   ]teoremamorre.pdf2.6M 
[   ]Teoretiko-metodologicheskie osnovi formirovaniya soderzhaniya doshkol'nogo obrazovaniya v Kazahstane..doc 63K 
[   ]TEORIA-ETNOGENEZA.pdf261K 
[   ]TEORIA-EURAZISTVO.pdf148K 
[   ]Teoria-spontannoi-detonacii-gazah1.pdf500K 
[   ]Teoria-spontannoi-detonacii-v-gazah2.PDF1.2M 
[   ]Teoriya i praktika log.cepeyPdf.pdf389K 
[   ]teplovye-effekty.pdf186K 
[   ]Tereshuk.pdf 11M 
[   ]Termostim.i tunel'.processi v lyuminoforah.pdf399K 
[   ]Terston.pdf4.4M 
[   ]testirovanie-rekombinantnogo-antigena.pdf252K 
[   ]tex_v2_n2_a10.pdf267K 
[   ]Text-1.pdf470K 
[   ]Text-2.pdf411K 
[   ]Tezisi dokladov Mezhdunarodnoy nauchno-obrazovatel'noy konferencii.pdf6.0M 
[   ]Tezisi mezhd.konf. Almati 2006 g..pdf2.4M 
[   ]The Proceedings of the European Society for Central Asian Studies Xth Conference.doc109K 
[   ]The synthesis of word forms of Turkic language using semantic neural networks.pdf8.1M 
[   ]THE- ACHIEVEMENT.pdf226K 
[   ]THE- DEVELOPMENT.pdf114K 
[   ]THE-ANALYSIS.pdf139K 
[   ]The-Composition-of-CO2-Extract-of-Echinops-ritro.pdf3.2M 
[   ]The-HardyľLittlewood.pdf141K 
[   ]The-inp.pdf1.2M 
[   ]THE-PROBLEM.pdf161K 
[   ]Theconditional.pdf195K 
[   ]Theory and problems.pdf5.8M 
[   ]Theory of Acoustic Emission for Micro-Cracks Appeared Under the Surface Layer Machining by Compressed Abrasive (2007) .1070v1 99K 
[   ]ThePDFoffluidparticle.pdf159K 
[   ]Thermodynamical-properties-dense-semiclassical-plasmas.pdf751K 
[   ]Tihonov.pdf3.6M 
[   ]Tihonovskaya konferenciya 2006.pdf2.2M 
[   ]TIL-MADENIETI.pdf154K 
[   ]tileshova.pdf133K 
[   ]Tinkham.pdf4.8M 
[   ]tipovoe-straitelstvo.pdf224K 
[   ]tiri-jurgen-shakarim.pdf163K 
[   ]Tirring.pdf2.6M 
[   ]Titce.pdf 91M 
[   ]Titchmarsh.pdf7.2M 
[   ]Titul'n-2.pdf441K 
[   ]Titul'n.jpg427K 
[   ]Titul'n.pdf711K 
[   ]titul'niy list Informatika 2013.doc 59K 
[   ]Titul'niy list_Informatika 2013.docx 16K 
[   ]Titul'niy list_Matematika 2013.doc 65K 
[   ]Titul1.jpg719K 
[   ]TituliOkonchat.doc 73K 
[   ]titulka i soderzhanie.doc 71K 
[   ]TIURKSKIE-PRAVITELI.pdf531K 
[   ]Tlepin Sh.V.,B.S.Sarsembaev Nekotorye voprosy stanovleniya konsulskoi slujby v Kazahstane i Rossii.pdf812K 
[   ]tlepina SH.pdf953K 
[   ]Tlepina SH.V. Nauchnaya,pedagogicheskaya,gosdarstvennaya deyatelnost akademika G.S.Sapargalieva.pdf1.4M 
[   ]Tlepina Uridiches.pdf 11M 
[   ]Tleukenov.Kulnazarov.Eltinova-1.pdf6.5M 
[   ]Tleukenov.Kulnazarov.Eltinova-2.pdf2.2M 
[   ]Tleukenov.Kulnazarov.Eltinova-3.pdf4.8M 
[   ]Tleukenov.Kulnazarov.Eltinova-4.pdf2.5M 
[   ]Tleukenov.Kulnazarov.Eltinova-5.pdf2.7M 
[   ]TleukhanovaNT.pdf256K 
[   ]tm1271.pdf777K 
[   ]tm2205.pdf1.9M 
[   ]tmp16.pdf262K 
[   ]tmp20.pdf220K 
[   ]tmp29.pdf556K 
[   ]Toda.pdf4.0M 
[   ]Tokin.pdf7.1M 
[   ]tokpaeva.pdf172K 
[   ]Tokusheva.pdf963K 
[   ]Tolen.pdf185K 
[   ]Tolgambaeva Religiya.pdf1.0M 
[   ]Tolmen.pdf 10M 
[   ]Tomsk_abstract-book_2012.pdf4.9M 
[   ]Toptigin.pdf3.8M 
[   ]Toraigyrov.pdf240K 
[   ]Toroidalconfigurationof.pdf707K 
[   ]Tr. mezhd. konf i teor.pribl..pdf1.7M 
[   ]Trahtman.pdf2.7M 
[   ]Transkripcija.pdf8.0M 
[   ]Transpornaya logistika ▓ chast'.JPG1.8M 
[   ]Transportnaya logistika 1 chast'PdF.pdf658K 
[   ]Transportnaya logistika 1- chast' 3.jpg891K 
[   ]Transportnaya logistika 1-chast' 1.jpg857K 
[   ]Transportnaya logistika 1-chast' 2.jpg673K 
[   ]Transportnaya logistika 1-chast' 4.jpg734K 
[   ]Transportnaya logistika 2-chast' 1.jpg1.0M 
[   ]Transportnaya logistika 2-chast' 2.jpg863K 
[   ]Transportnaya logistika 2-chast' 5.jpg872K 
[   ]Transportnaya logistika 2-chast'.jpg1.8M 
[   ]Transportnaya logistika 2-chast'PdF.pdf812K 
[   ]Transportnaya logistika 5.jpg506K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 1.jpg590K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 2.jpg889K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 3.jpg903K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 4.jpg952K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 5.jpg942K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 6.jpg928K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 7.jpg947K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya 8.jpg525K 
[   ]Transportnaya logistika zadachi, tendencii razvitiya.jpg402K 
[   ]Transportnaya logistika zadachi, tendencii razvitiyaPdF.pdf2.4M 
[   ]transportnaya-logistika-1-chast.pdf3.8M 
[   ]transportnaya-logistika-2-chast.pdf2.6M 
[   ]trehtomnik.pdf194K 
[   ]Treiman.pdf1.2M 
[   ]trexyazychie.pdf218K 
[   ]Trofimova.pdf8.3M 
[   ]trubetskoy_my i drugie.pdf1.4M 
[   ]Trubnikov.pdf5.3M 
[   ]TRUDI KarGTU-2012 Word.pdf3.3M 
[   ]Trudi konf. po diff.ur..pdf2.3M 
[   ]TRUDI MEZHDU.KONFERENC.TEOR.FUN..pdf2.9M 
[   ]trudiMezhdu.korfer.po teori.furk..pdf3.1M 
[   ]trudiMI.AN SSSR.pdf 14M 
[   ]trudnosti-leksikogr.pdf283K 
[   ]Tsymbalova.pdf135K 
[   ]Tulepenov.pdf 11M 
[   ]tulpardyn-syny.pdf214K 
[   ]tunnel.pdf272K 
[   ]TUR-TUS-ATAULARY.pdf166K 
[   ]Turapova.pdf 67K 
[   ]Turchina.pdf9.0M 
[   ]turik-xalkynyn.pdf224K 
[   ]Turisbek R.pdf736K 
[   ]TURKILERDIN-TIL-MASELESI.pdf168K 
[   ]turmystyk-zorlyk.pdf286K 
[   ]Tursin Jurtbai M.Jumabaev.pdf4.5M 
[   ]tursin-jurtbaidin.pdf218K 
[   ]tursin-zhurtpai-prozasindagi.pdf243K 
[   ]tursin-zhurtpai.pdf190K 
[   ]Tursyn Jurtbai.pdf2.0M 
[   ]tusterdin-adam.pdf465K 
[   ]tutkirlik-jane-jilu-otkizgiwtik-koefcentteri-jiludan-taueldi-bolatin-jilu-konvekcia-tendeuine-koilgan-bastapki-wettik-eseptin-wewimdiligi (converted).page1.pdf 25K 
[   ]tutkirlik-jane-jilu-otkizgiwtik-koefcentteri-jiludan-taueldi-bolatin-jilu-konvekcia-tendeuine-koilgan-bastapki-wettik-eseptin-wewimdiligi.pdf490K 
[   ]Tutubalin.pdf5.9M 
[   ]Tuyakpayeva.pdf139K 
[   ]tvorcheskaya-biografia.pdf240K 
[   ]Two-dimensional-tunnel-bifurcations.pdf462K 
[   ]Two-dimensional.pdf365K 
[   ]Tykochinskaya.Osnovy.pdf9.5M 
[   ]tynys-demikpesimen-aurgan-naukastardagu.pdf217K 
[   ]UBT_ny.pdf239K 
[   ]Uch-metod.posobie.jpg 91K 
[   ]Uch-metod.posobie1.jpg267K 
[   ]Uch-metod.posobiePdf.pdf402K 
[   ]UDK 341.docx 38K 
[   ]UDK.pdf255K 
[   ]Uest.pdf2.5M 
[   ]UFA 2011 conference.pdf1.6M 
[   ]Uflyand.pdf5.1M 
[   ]Ugrozi ekologii Kazahstana i puti ih predotvrasheniya.doc650K 
[   ]Uilson.pdf 13M 
[   ]Uittaker.pdf4.1M 
[   ]UKRAIINSKIE-IZMERENIE-EVRAZISTVO.pdf266K 
[   ]UKRAINCI V KAZAHSTANE V NOVOE VREMYa.doc 39K 
[   ]Ular umit.pdf1.4M 
[   ]ulibka.docx 15K 
[   ]ult-murasi.pdf186K 
[   ]ult-ruxy.pdf216K 
[   ]ULTTYK-ADEBIETTANU.pdf148K 
[   ]ulttyk-kundylyktardi.pdf189K 
[   ]ulttyk-til.pdf896K 
[   ]Umedzawa.pdf4.4M 
[   ]Umedzawa_guant.pdf5.4M 
[   ]UMP Sadikovoy.pdf548K 
[   ]UMZh T.28 ╣6.pdf7.5M 
[   ]Ung.pdf4.8M 
[   ]univerbaciya.pdf247K 
[   ]universalnie_frectalnie_osobennosti.pdf209K 
[   ]Universitett│k b│l│m beru zh?yes│ndeg│ ?aza? t│l│ o?uli?tari san men sapa.doc 35K 
[   ]Uorner.pdf4.3M 
[   ]upr.doc 96K 
[   ]Upravlenie dvizheniem transportnih sredstv.doc3.0M 
[   ]upravlenie.pdf170K 
[   ]urani-aslash-ideasi.pdf349K 
[   ]urani.pdf292K 
[   ]uranim.pdf217K 
[   ]Urbanisticheskaya poetika v mirovoy literature.doc 59K 
[   ]uskoritelnoi-kompleks-na-baze-ciklatrona-DC-60-v-g-Astana-Poluchenie-uskorennih-puchkov-tiajolih-ionov-i-pervie-analiticheskie-rezultatev.pdf1.8M 
[   ]uslovia-sushestvovanie-voln-Relia-vdol-svobodni-granici-anizotropnih-sred-kubicheskoi-rombicheskoi-.pdf954K 
[   ]usloviya.pdf330K 
[   ]usp.M.N.T37.pdf1.4M 
[   ]Uspenskii.pdf2.1M 
[   ]Ustelimova.pdf1.2M 
[   ]Utkin.pdf4.2M 
[   ]uufa 2011.pdf824K 
[   ]uvelechenie-potenciala-robastnoi-ustoichivosti-sisten-upravlenie.pdf516K 
[   ]Uzdyk Mugalim 2010.pdf1.3M 
[   ]uzilissiz.pdf507K 
[   ]V Kursti? zh?mirnal?an ?d│stemel│k n?s?aular.docx 31K 
[   ]v MCKR publikaciya Dosanovoy G.M..doc 49K 
[   ]v pustine.docx 52K 
[   ]v74-52.pdf380K 
[   ]v74-53.pdf538K 
[   ]v74-7.pdf379K 
[   ]v74-8.pdf407K 
[   ]v74-8nur.pdf407K 
[   ]Vainberg.pdf1.0M 
[   ]Vainshtein.pdf 16M 
[   ]valiutalyk.pdf170K 
[   ]Van Eyk-Dunn.Proteomic.pdf6.3M 
[   ]Van-der-Varden.pdf1.1M 
[   ]Varden.pdf 13M 
[   ]Vasidzu.pdf6.2M 
[   ]Vasil'eva.Laboratornye.pdf9.3M 
[   ]Vasilev.pdf1.7M 
[   ]Vasilev_tranz.pdf8.2M 
[   ]Veinberg.pdf 11M 
[   ]Vek Gumileva tol'ko nachinaetsya.docx 73K 
[   ]Vekshtein.pdf1.2M 
[   ]Ventcel.pdf9.0M 
[   ]Vereshagin1.pdf406K 
[   ]Vereshagin2.pdf906K 
[   ]Vereshagin3.pdf572K 
[   ]Vernetsya v step' drofa.docx 16K 
[   ]Veselov.pdf3.9M 
[   ]Vesovie fun. prostranstva1.pdf 12M 
[   ]Vesovie fun. prostranstva10.pdf6.8M 
[   ]Vesovie fun. prostranstva11.pdf6.4M 
[   ]Vesovie fun. prostranstva12.pdf7.3M 
[   ]Vesovie fun. prostranstva13.pdf9.0M 
[   ]Vesovie fun. prostranstva2.pdf9.7M 
[   ]Vesovie fun. prostranstva3.pdf 11M 
[   ]Vesovie fun. prostranstva4.pdf8.6M 
[   ]Vesovie fun. prostranstva5.pdf4.8M 
[   ]Vesovie fun. prostranstva6.pdf6.2M 
[   ]Vesovie fun. prostranstva7.pdf7.0M 
[   ]Vesovie fun. prostranstva8.pdf7.2M 
[   ]Vesovie fun. prostranstva9.pdf6.8M 
[   ]Vest. KazGU ╣5(19).pdf1.1M 
[   ]vestnik 2012.doc2.7M 
[   ]Vestnik EGU ╣3.pdf2.5M 
[   ]Vestnik Ekonomika 1,2013-Erkebulan 24052013.doc6.8M 
[   ]Vestnik ENU 2-3. 2012. v tipografiyu.doc1.8M 
[   ]Vestnik ENU 2010-1.pdf4.9M 
[   ]Vestnik ENU 2010.pdf1.2M 
[   ]Vestnik ENU2012.pdf1.9M 
[   ]Vestnik Kargu.pdf2.8M 
[   ]Vestnik SGU, 1, 2010.pdf3.0M 
[   ]Vestnik SGU, 2, 2008.pdf1.2M 
[   ]vestnik-enu-2004.doc1.6M 
[   ]vestnik-seilhan.pdf5.6M 
[   ]vestnik-yur-2004.doc1.4M 
[   ]Vestnik. F- i F2- centri v LiF, obluchennom ionami kriptona s energiey 117 MeB.pdf6.2M 
[   ]VESTNIK.AN.RK ╣1.pdf2.3M 
[   ]Vestnik.pdf2.3M 
[   ]Vfgdueiulshmf NIMB 2012.pdf933K 
[   ]Vich. tehn. t.5 ╣2.pdf5.7M 
[   ]VIG3JUXDV1content.pdf707K 
[   ]VIG3JV1O0Bcontent.pdf511K 
[   ]VIG3JV1PDKcontent.pdf495K 
[   ]VIG3JV1QGUcontent.pdf509K 
[   ]VIG3JV2M9Jcontent.pdf541K 
[   ]VIG3JV2PL0content.pdf574K 
[   ]VIG3JV2TJAcontent.pdf547K 
[   ]VIG3JV352Xcontent.pdf525K 
[   ]VIG3JV36XAcontent.pdf494K 
[   ]VIG3JV386Jcontent.pdf524K 
[   ]VIG3JV42BScontent.pdf496K 
[   ]VIG3JV46TTcontent.pdf588K 
[   ]Vigner.pdf4.9M 
[   ]Vihodec.pdf5.3M 
[   ]Vildeman.pdf3.7M 
[   ]Vilenkin.pdf2.8M 
[   ]Vilhelmsson.pdf2.4M 
[   ]Visokorazreshayushaya mikroskopiya uristallov LiF, obluchennih visokoenergichnimi ionami i elektronami.pdf1.3M 
[   ]Vitrichenko.Metody.pdf2.3M 
[   ]Vityazev_spektr.pdf483K 
[   ]Vityazev_wavelet.pdf1.0M 
[   ]vizualnaya-ekologiya.pdf629K 
[   ]VKLAD-L.N.GUMILEVA.pdf216K 
[   ]vklyuchit' v sbornik.doc 14M 
[   ]VLAST' ORGANIZOVANNIH GRUPP INTERESOV.doc 77K 
[   ]VLIANIE-MIGRACIONNYH-POTOKOV.pdf175K 
[   ]VLIANIE-POSLEDSTVII-VTOROI-MIROVOI-VOINY.pdf163K 
[   ]Vliyanie neytronnogo oblucheniya i skorosti deformacii na.docx 48K 
[   ]Vliyanie redkozemel'nih ionov.pdf824K 
[   ]vliyanie-antropognnyh-factorov-na-sostoyaniye-reki.pdf210K 
[   ]vliyanie-dovabok.pdf116K 
[   ]vliyanie-geliya.pdf399K 
[   ]vliyanie-neitronnogo.pdf376K 
[   ]vliyanie-neitronnogo2.pdf826K 
[   ]vliyanie-oblushenie.pdf904K 
[   ]vliyanie-parametrov.pdf761K 
[   ]vliyanie-protivovirusnih-rastitelnuh-preparatov.pdf179K 
[   ]vliyanie-stareniya.pdf1.0M 
[   ]vliyanie-temperatury.pdf1.2M 
[   ]vliyanie.pdf164K 
[   ]vn1101agr07.pdf 68K 
[   ]vn19.pdf3.2M 
[   ]vn20091_biology.pdf1.1M 
[   ]VnTitul'n.pdf348K 
[   ]void.pdf3.9M 
[   ]Voishvillo.pdf3.8M 
[   ]Vokaze.pdf746K 
[   ]Volgov.pdf7.5M 
[   ]Volk.What Is Death.pdf1.6M 
[   ]Volkenshtein.pdf5.7M 
[   ]Volkenstein.Physical.pdf4.0M 
[   ]Volkov.pdf2.9M 
[   ]volkova.pdf2.1M 
[   ]Volkoviskii.pdf 29K 
[   ]Vonsovskii.pdf4.9M 
[   ]voprosy.pdf184K 
[   ]Vorobev.pdf2.0M 
[   ]Vorovich.pdf4.5M 
[   ]Vorovich_kont.pdf 12M 
[   ]Vorovich_upr.pdf5.7M 
[   ]vosstrebovan opit.docx 14K 
[   ]VOZMOZHNOSTY-I-OGRANICHENIE.pdf236K 
[   ]Vulih.pdf4.9M 
[   ]vulshvshkshmftshu.pdf469K 
[   ]vyavleniye-associacii-polimoprfizmogenov.pdf224K 
[   ]vydelenieye-i-izucheniye-antagoncheskih.pdf186K 
[   ]Vzaimdeyst.elementov inf.res.log.pdf785K 
[   ]vzaimodeistvie-dizaina.pdf449K 
[   ]Vzaimodeyst.elementov inf.res.log..jpg355K 
[   ]Vzaimodeyst.elementov inf.res.log.1.jpg918K 
[   ]Vzaimodeyst.elementov inf.res.log.2.jpg675K 
[   ]Vzaimodeyst.elementov inf.res.log.3.jpg859K 
[   ]Vzaimodeyst.elementov inf.res.log.4.jpg881K 
[   ]Warshel.Computer.pdf3.5M 
[   ]Web-texnologiyalar.pdf172K 
[   ]Website- as-an-information.pdf467K 
[   ]Weil.pdf4.5M 
[   ]Westermeier-Naven.Proteomics.pdf8.3M 
[   ]wirotnyi-effekt.pdf165K 
[   ]Wittaker1.pdf4.4M 
[   ]Wittaker2.pdf6.6M 
[   ]Xakim.pdf306K 
[   ]xarakteristika.pdf323K 
[   ]xemokinderdin-jiktelyi-sipattamasy.pdf209K 
[   ]xgcmtcmslgfcfqvphmqf-cclpcgcqeefblhofkaxvhd.pdf130K 
[   ]Yakobi.pdf5.7M 
[   ]Yakovlev.pdf1.9M 
[   ]yanov_uchenie.pdf1.0M 
[   ]Yaroslavskii.pdf5.9M 
[   ]Yaroslavskii_optika.pdf3.2M 
[   ]Yastrebov.pdf4.8M 
[   ]Yavorskii.pdf 10M 
[   ]Yavorskii1.pdf7.9M 
[   ]Yavorskii2.pdf 13M 
[   ]Yergaziyeva.pdf113K 
[   ]Yermekbayeva ICMSCE_2012.pdf199K 
[   ]Yerzhumanova-1.pdf158K 
[   ]Yerzhumanova.pdf196K 
[   ]Young.Computational.pdf2.2M 
[   ]YOUTH.pdf206K 
[   ]yurta.pdf619K 
[   ]Zacepina.Svojstva.pdf2.1M 
[   ]zadacha-dirihle.pdf3.0M 
[   ]zadachi po fizike.pdf7.2M 
[   ]zadachi-kinematiki-prostranstvennogo-rijachnogo-mehanizma-podiemnogo-ustroistva.pdf562K 
[   ]zadachi-razvitia-i-puti-sovershenstvovanie-konteinernih-perevozok-v-Kazakhstane.pdf380K 
[   ]Zaharev.pdf2.0M 
[   ]Zaharova.pdf343K 
[   ]Zaicev.pdf1.8M 
[   ]Zaikin.pdf4.8M 
[   ]Zaiman.pdf5.2M 
[   ]Zaitsev.Neklassicheskie.pdf212K 
[   ]Zajcev.Zadachi.pdf7.3M 
[   ]zarubezhnyi-opyt-primenenia.pdf1.3M 
[   ]Zaslavskii.pdf2.4M 
[   ]Zaslavskii_stohast.pdf3.8M 
[   ]Zavarzin-Kolotilova.Vvedenie.pdf5.5M 
[   ]ZAVET-VELIKIH.pdf335K 
[   ]Zeeger.pdf 11M 
[   ]Zeifert.pdf2.3M 
[   ]ZEINEP-AHMETOV.pdf183K 
[   ]Zeinullina.pdf670K 
[   ]Zelevinskii.pdf1.1M 
[   ]zem.doc1.2M 
[   ]Zemel'naya politika Sovetskogo gosudarstva v 60-e - 80-e godi XX veka celevie ustanovki i rezul'tati.doc394K 
[   ]Zemel'naya politika Sovetskoy vlasti v Kazahstane v 30-e godi HH veka.doc247K 
[   ]Zemel'naya reforma v Kazahstane vzglyad istorika.doc 79K 
[   ]Zemleustroystvo kazahskogo naseleniya v I treti XX veka iz istorii izucheniya problemi.doc1.0M 
[   ]Zenkevich.pdf3.6M 
[   ]Zeveke.pdf 12M 
[   ]Zh.Artikbaev ulttanu alippesi.pdf3.8M 
[   ]Zh?MISPEN ?AMTU SALASINDA?I GENDERL▓K AYIRMASHILI?.doc 61K 
[   ]Zha?a ?oldanistar ľ lingvistikali? zerteud│? nisani ret│nde.doc 48K 
[   ]zhab.docx6.0M 
[   ]ZHAI-SOILEMDEGI-OKSHAU-SOZDER.pdf165K 
[   ]ZHALPU-HALUK-TILINDEGI-BALAMASYZ.pdf140K 
[   ]ZHALPYTURKILIK-TERMYNKOR.pdf174K 
[   ]ZHANAT-ELSHIBEKTIN-SHYGARMALARY.pdf186K 
[   ]Zhansautov K.S., Tazhibaeva G.D..doc 54K 
[   ]ZHARNAMALAR-ZHANGYRYGY.pdf157K 
[   ]Zhay s?ylemdeg│ sub'ekt│n│? ??rilimdi?, semantikali? erekshel│kter│.docx4.1M 
[   ]ZHIGIT-GENDERLIK-KONCEPTISI.pdf165K 
[   ]ZHIVIA-V-CHUZHIH-SLOVAH-CHUZHOGO-DNIA.pdf164K 
[   ]zholdybayuly.pdf3.4M 
[   ]Zhomartov R..pdf5.8M 
[   ]Zhumabekova F.pdf3.7M 
[   ]Zhur. Vich.mat. i mat.fiz..pdf2.7M 
[   ]Zhurnal Politeks. Energeticheskaya bezopasnost' Evropeyskiy soyuz, Rossiya i Kazahstan.doc241K 
[   ]Zhurnal_of_lyumin_2009.pdf406K 
[   ]ZHUSIP-BALASAGUN.pdf145K 
[   ]Zhusupbekov-Bazarbayev-Matsumoto.pdf344K 
[   ]Zhusupbekov-Bazilov-Ashkey.pdf269K 
[   ]Zi.pdf 15M 
[   ]Zigel.Lunnye.pdf3.6M 
[   ]Zilberman_el.pdf9.0M 
[   ]Zinovev.pdf1.7M 
[   ]ZNA4ENIE-SLOVO-CHINGIS.pdf190K 
[   ]znsl4251.pdf264K 
[   ]znsl4507.pdf205K 
[   ]znsl4508.pdf252K 
[   ]znsl4703.pdf158K 
[   ]znsl5354.pdf176K 
[   ]znsl5537.pdf238K 
[   ]Zommerfeld.pdf1.6M 
[   ]Zozulya.pdf5.2M 
[   ]ztf_t74v02_03.pdf165K 
[   ]ztf_t76v06_13.pdf300K 
[   ]Zubov.pdf2.9M 
[   ]Zumagalijev O.N..pdf 98K 
[   ]Zvelto.pdf7.7M 
[   ]zvmmf1516.pdf1.3M 
[   ]zvmmf3257.pdf113K 
[   ]~$ Materiali VII Mezhdunarodnoy nauchnoy konferencii molodih uchenih Nauka i obrazovanie - 2011 (25-26 aprelya 2011 g.). Sbornik 5. Sekciya 4 - Social'n.docx162  
[   ]~$dakciya ╣1.docx162  
[   ]~$ornik 9.docx162  
[   ]~$spisok.docx162  
[   ]ôMIGRATION OF ETHNIC KAZAKHS TO HISTORICAL NATIVE LAND.doc 31K 
[   ]źM?deni m?ra╗ ba?darlamasi ?aza?standi? m?deni sayasatti.docx 26K 
[   ]źZahvat real'nosti╗ sovremennimi SMI.doc 39K